KEGG   Drosophila ananassae: Dana_GF13019Help
Entry
Dana_GF13019      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dana_GF13019
Enzymes [BR:dan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     Dana_GF13019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 6495862
NCBI-ProteinID: XP_001959733
FlyBase: FBgn0090052
UniProt: B3MEE9
Position
Unknown
AA seq 280 aa AA seqDB search
MRIRRNPLPRRLVDILCFLLIGIFLPVVFMFEIVVVLPNFHDPGSFFHTLHFLMAMFLVF
NIKSNMIACMMIDTSCDVKKIEPPEDHSDWRECDICQKLAPPRSWHCKICGVCVLKRDHH
CIYTGCCIGHRNHRFFMGFIFYLFVGSVYALVYNSIYLWVFQAHIYCHWFTLFKLLNPLF
LLFTGNFWSNMYLIFYGLNILAFLYGVLLLAYHVPIILRGGVSADRTLASKHRYDRGVRQ
NLRSVFGNRMHLAWISPLIRSDLPDDGYHWKPTIDEQEKD
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccgtagaaatccactgccccgccggctggtggacattttgtgcttccttctc
attggcatctttctgccggtggtcttcatgttcgagattgtggtggtgcttcccaatttc
cacgatccaggtagtttcttccacaccctgcactttttgatggccatgttcctcgtcttc
aatatcaagagcaacatgattgcctgcatgatgatcgatacgagttgtgatgtcaagaag
atagaaccaccagaggatcattcggattggcgagagtgcgacatctgccagaaattggcc
ccgcccaggtcttggcattgcaagatctgtggggtttgcgtcctgaagagagaccatcat
tgcatatacaccggctgctgcatcggtcaccgaaaccatcgcttcttcatgggattcatc
ttctacctctttgtgggatccgtgtacgccctggtgtacaactctatttacctgtgggtg
ttccaggcccacatctactgccactggttcacactattcaaactgctcaacccactgttc
cttcttttcacggggaacttctggagcaacatgtacctgatcttctacggcttgaacatc
ctagccttcttgtatggcgttcttcttttggcctaccatgtgcccatcattttgcgagga
ggagtttccgcagatcgcactttggcgagcaaacacagatacgatcgaggagtccgccaa
aaccttagaagcgtatttggcaaccgcatgcacttggcgtggatatcgccgctaatacgc
agcgacctgccggatgatggataccactggaaacctaccatcgatgagcaggagaaagac
tga

DBGET integrated database retrieval system