KEGG   Drosophila ananassae: Dana_GF13192Help
Entry
Dana_GF13192      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
dan  Drosophila ananassae
Pathway
dan00830  Retinol metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    Dana_GF13192
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     Dana_GF13192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Pyr_redox_3 NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 6496035
NCBI-ProteinID: XP_001960088
FlyBase: FBgn0090225
UniProt: B3MHS3
Position
Unknown
AA seq 293 aa AA seqDB search
MVCDAKFTKQTVETGKVFIVTGANSGIGKETALEIAKRGGTVYMACRDLNRSEEIRVEIE
NISGNSNVFVRELDLSSLESIRQFAESFKKEQDKLHVLINNAGVMHTPKTLTKDGFELQL
GVNHIGHFLLTHLLLDVLKKSAPSRIVNLSSAAHLLGSINMDDLNSEQPYSRIGAYNQSK
LANVLFTRELARRLEGTGVTVNAVHPGAVNTELARTWSPAVKIALTPLMWAFKTPKSGAQ
TSLYAALDPDLELVTGQYFSGCKPANVASAAKDDKTSQFLWSESEKWTGIEVY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggtgtgtgacgcaaagtttacaaaacagacagtggaaaccggaaaggttttcattgtc
acaggagccaatagtggcatcggaaaggagacagctctagaaattgccaaaagaggagga
actgtctatatggcctgccgggacttaaatagatctgaagagatccgggtggaaatagaa
aacatttcggggaattcaaatgttttcgtgagagaattggacttgagttctttggaatcg
attcgccagttcgcagaaagtttcaaaaaagagcaggataagctccacgtcctgatcaac
aatgctggggtaatgcacaccccaaaaacccttactaaggatgggtttgaattgcagttg
ggtgttaatcacatcggccactttctgctcactcatttactgttggatgttttaaagaaa
tcggcgcctagtcgcatagtcaacttatcaagcgctgcccatttgcttggttccatcaat
atggatgacttgaacagtgaacaaccctacagtcgcatcggagcctacaaccaaagcaaa
ctggccaatgttttgttcaccagggagctggcaaggaggttggaaggaaccggtgtaacc
gtcaatgccgtacatccaggcgccgtgaacacagaactggcaaggacttggagccccgcc
gtaaagattgctttaactccattgatgtgggcttttaaaacaccgaaaagtggagctcaa
acttctctttatgccgcactggatcctgatctggaactggttactggtcagtactttagc
ggctgcaagccagcgaatgtggcatctgctgccaaggacgataaaacttcacagttcttg
tggtctgagagcgagaagtggactgggatcgaagtatactaa

DBGET integrated database retrieval system