KEGG   Drosophila ananassae: Dana_GF13200Help
Entry
Dana_GF13200      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
dan  Drosophila ananassae
Pathway
dan04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    Dana_GF13200
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dana_GF13200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 6496043
NCBI-ProteinID: XP_001960107
FlyBase: FBgn0090233
UniProt: B3MHU2
Position
Unknown
AA seq 170 aa AA seqDB search
MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaaacatcactgcccatggaaatgtgttccaatttcgacgccgatgagatc
cgtcgcttgggaaaacgcttccgcaaactggacctcgacaactccggagctttgagtgtg
gacgagttcatgtcgctgccggagctgcaacagaacccactggtccagcgagtgattgac
attttcgatgccgatggcaacggcgaggtggacttcaaggagttcatccagggcgtctca
cagttcagtgtcaagggcgataagctgtcgaagctgcgcttcgcctttcgcatctacgac
atggacaacgatggctatatatccaacggagaactgtttcaggtgttaaagatgatggtg
ggaaacaatctgaaggacacgcaactgcagcagatcgttgacaagacaatcggattcgcg
gacaaggacgaggatgggaagatatcgttcgatgagttctgctcggtggtcggcaacacg
gacatacacaagaagatggttgttgacgtctaa

DBGET integrated database retrieval system