KEGG   Drosophila ananassae: Dana_GF13732Help
Entry
Dana_GF13732      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dan  Drosophila ananassae
Pathway
dan00480  Glutathione metabolism
dan00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Dana_GF13732
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Dana_GF13732
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Dana_GF13732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 6496568
NCBI-ProteinID: XP_001961173
FlyBase: FBgn0090759
UniProt: B3MHY5
Position
Unknown
AA seq 195 aa AA seqDB search
MANTETVFLALTAGMGILVTLVTHYRLYQDLETMRWRLKVLSLTVKDTFGQPISLNQFAG
QVLLVVNIASRCGLTSSQYAGLHELREKYEERGLSILNFPCNQFGAQMPESDGREILEHL
RQKKANIGHIFAKIKVNGRNADPLYKLLTRKAPRIEWNFVKFLIDRKGNIYGRYGAEKKP
AVLVNDIERLLLEAK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggccaacacagaaactgtatttctcgccctcacggccggaatgggaattctggtgact
ctcgtcacacattacaggctctatcaggacctggagactatgcgttggcgcttaaaggta
ttatccctgacggtgaaggacacttttggacagcccataagcttaaaccaattcgcgggc
caagtcctgctggtcgtgaatatagcttccagatgcggtctcacctcttcccaatatgct
ggcctacacgaactaagggaaaaatatgaggaacgtggcctgagcatcctgaactttcct
tgcaaccaattcggagcacagatgccagagtcggatggccgggaaatactggagcatctc
cgccaaaagaaggctaatataggccatatttttgcaaaaatcaaagtaaatggccgcaat
gcagatcccctgtacaagctactcacccgaaaagctccgcggatagagtggaattttgtc
aagtttctgatcgatcggaagggaaatatctatggccggtatggcgcagaaaagaagcca
gctgtcctggtaaatgacattgagaggttgctgctggaagccaaataa

DBGET integrated database retrieval system