KEGG   Drosophila ananassae: Dana_GF13746Help
Entry
Dana_GF13746      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dan  Drosophila ananassae
Pathway
dan00450  Selenocompound metabolism
dan00970  Aminoacyl-tRNA biosynthesis
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dana_GF13746
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dana_GF13746
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dan01007]
    Dana_GF13746
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dan03016]
    Dana_GF13746
Enzymes [BR:dan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Dana_GF13746
Amino acid related enzymes [BR:dan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dana_GF13746
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dana_GF13746
 Prokaryotic type
   Other AARSs
    Dana_GF13746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS GST_N_5 GST_C_3 tRNA-synt_1 GST_C GST_C_2 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 6496582
NCBI-ProteinID: XP_001961196
FlyBase: FBgn0090773
UniProt: B3MI08
Position
Unknown
AA seq 1020 aa AA seqDB search
MIIYTNEGNPLGLQLLMLAKFAKQAVKVQLVNLNDAKFKDLLVLPTLELDNGLRLFSPSA
IAKYLLVDEGQLRDEWLEWSATLLAPALAHHMAVGHKADANALPVLNALVKKLDDNLKAT
PYLAGNKLTAADIAVWSLLAPEGTLKGAQNVESLRDWYGRVKALPEVQEVLSEQPLKDLS
FNALQQSNRYGGLHHVPLKRLSLADAGKLLVDTTPTVADTVTDEEISAAQAAFTYTAPKE
VKEERTILPKPGQRNVLITSALPYVNNVPHLGNIIGCVLSADIFARYSRSAGYNTLLICG
TDEYGTATENKALAENLTPREICDKYFELHNSIYRWFGIGFDYFGRTTTQEQTDIVQEAF
KDVLSAGYIIKESVEQLLCQKCDRFLADRFVEGTCPHPGCGYEDARGDQCDKCGKLVNAT
ELIRPRCKVCNSAPVIRSSDQLFIDLPKAEPQLKDWVDKSEGGWTNNAKVITRAWLKEGL
KPRCITRDLKWGIPVPHKGFEKKVFYVWFDAPFGYVSMTKRYTKEYQQWWQPAKGTDVEL
FQFMAKDNVPFHSVVWPSILLAVNKGHTLVSHIMATEYLNYEDGKFSKSRGIGVFGNDAQ
ETGIPADVWRFYLASARPEGQDSSFSWNDLAARNNSELLNNLGNFVNRALVFCEKNFNST
VPEVALTQDELILLALINRELKGYINSMEKAKLRDGIRHLLAVSRHGNGYMQTQQPWVLL
KGSDEQKKRAATIIGLSANIACLLANLLFPYMPTTARTLFSQLNAKQTPLNAEKPLATLL
LPAGHKIGKPAPLFAKLEQAFIDELKGKYGGAQESKASPNTQTSAADLEKAVAAQADKVR
QLKASTKDKAQWQPEVNKLLDLKKQLEEAKKTAPASTAAPASAPTNGSQSVKDLEKAIQE
QGDKVRKLKGSTKDKSVWQPEVDVLLGLKKQLEAAQKAAKEAPASAPPAPAPSSAANPAQ
VKALEDKIALQGEKVRTLKASGDASVWKPEVDILLALKNELAALTGAPAAGGQGKGKKKK
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgatcatttacacaaacgagggtaatcctctggggctgcagctgctaatgctggcgaag
tttgccaagcaggcggtgaaggtgcagctggttaacctaaatgatgccaagtttaaggac
ctgctggtactgcccaccctggaactggacaatggacttcgcctattctcgccctcggcc
attgccaaatatttgttggtggacgagggacaactgcgggacgagtggctggagtggtcg
gccacgttgctggccccggctctagcccatcacatggccgtgggtcacaaggcggacgcc
aacgctctgcccgttctaaatgccctcgtaaagaaactggacgacaacctgaaagccact
ccctacctcgctggcaacaagctcaccgccgccgacattgccgtctggtcgcttttggct
cccgaaggcaccttgaagggcgcccagaacgtggagagcctgagagattggtatggacgt
gtcaaagcgctcccggaggtccaggaggtgctttcggaacaacccctgaaggatctcagc
ttcaatgccctgcagcagtcgaatcgctatggcggtttgcatcatgttcctctcaagcgt
ctcagtctggccgatgcgggcaaactgctggtggacaccacacccacagtggccgatacg
gttaccgatgaggaaattagcgccgcccaggccgccttcacctacacagctcccaaagag
gttaaggaggagcgcaccatccttcccaagcctggccaacgcaatgtgcttatcacctcg
gctctgccttatgtcaacaatgttcctcatcttggcaacatcatcggctgcgttctgtct
gcggacatcttcgcccgctactcccggtcggcgggttacaacaccctgctgatctgcggc
acggatgaatatggcacggccactgaaaacaaagctctggctgagaacttgactccccgc
gagatctgcgacaagtacttcgagctgcacaactcgatctaccgctggtttggcattgga
ttcgattactttggacgcaccaccacacaagagcaaacagatattgtccaagaggctttt
aaggatgtcctgagtgctggctacatcatcaaagaaagcgtcgagcagctgctttgccaa
aagtgtgatcgtttcctggctgatcgatttgtggagggtacttgcccgcatcctggttgc
ggctacgaagatgctcgcggtgatcagtgcgacaagtgcggcaaactagtgaacgccacc
gaactgatccgtccgcgctgcaaagtgtgcaatagcgcaccagtgatccgttcctctgac
cagctgtttatcgatctgcccaaggctgagcctcaactcaaggattgggtggacaagtcg
gagggcggctggacaaacaacgctaaagtcatcacaagggcgtggctgaaagagggcctg
aagccacgctgcatcacccgagacctgaaatggggcatccctgtgccgcacaagggcttc
gagaagaaggtgttctacgtctggttcgacgctcccttcggctacgtctccatgaccaag
cgctacaccaaggagtaccagcagtggtggcagcccgccaagggaaccgatgtggagctg
ttccagttcatggccaaggacaacgtgcccttccactcggtggtgtggcccagcatcctg
ctggccgttaacaaaggtcacaccttggtctcccacatcatggccacggagtatttgaac
tacgaggatggcaagttcagcaagagtcgaggaattggagttttcggcaacgacgctcaa
gaaacaggcattccggctgacgtctggcgtttctatcttgcctccgcccgtccggaaggt
caggactctagcttcagttggaacgatctggctgcccgtaacaactcggagctcctgaac
aacctaggaaactttgtgaatcgcgccttggtcttctgcgaaaagaacttcaacagcact
gttcccgaagtggcgctcacccaggatgaactgattctgttggccctgatcaaccgtgag
ctcaagggttacatcaactccatggagaaggccaaacttcgcgatggtattcgtcacttg
ttggccgtttcgcgacatggaaacggttacatgcaaacccaacagccgtgggtgctgctc
aagggcagcgatgagcagaagaagcgtgccgcgaccatcatcggactatcggccaacatt
gcctgcctgctggccaatctcctcttcccctacatgccgaccacagccaggacactgttc
agccagctgaacgccaagcagactccgctcaacgcagagaaacctcttgccactctgctg
cttcctgctggccacaaaatcggaaaacccgctccgctctttgccaaattggagcaggct
ttcatcgatgaactgaagggaaaatacggaggagctcaggagtccaaggctagcccgaat
acgcagaccagtgccgctgacttggagaaggctgtggcagctcaggcggacaaagtgcgc
cagctgaaggcgagcaccaaggacaaggcccagtggcagccagaggtgaacaagcttctc
gatctgaagaagcaactggaggaggctaaaaagactgcaccagcttccacagctgctccc
gcatccgctcctacgaatggctcacaatccgtgaaagatctggagaaggccatccaggag
cagggcgacaaggtgcgcaaactcaaagggagcacaaaagacaagtccgtgtggcagccg
gaggtggatgttctgctgggcctgaaaaagcaactggaggcggcacaaaaagctgccaag
gaggcacctgcttctgcccctcctgctcctgctccatcatccgcagcgaatcccgcccaa
gtcaaagccttggaagacaaaattgctctgcagggggaaaaagtacgaaccctgaaagcc
tccggagatgcctccgtgtggaagcctgaagttgatattctcctagccctcaagaacgaa
ctggcggcgctgactggagcaccggccgccggtggacaaggcaaaggcaaaaagaagaaa
tag

DBGET integrated database retrieval system