KEGG   Drosophila ananassae: Dana_GF14288Help
Entry
Dana_GF14288      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
dan  Drosophila ananassae
Pathway
dan00052  Galactose metabolism
dan00511  Other glycan degradation
dan00531  Glycosaminoglycan degradation
dan00600  Sphingolipid metabolism
dan00604  Glycosphingolipid biosynthesis - ganglio series
dan01100  Metabolic pathways
dan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dana_GF14288
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dana_GF14288
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Dana_GF14288
   00604 Glycosphingolipid biosynthesis - ganglio series
    Dana_GF14288
   00511 Other glycan degradation
    Dana_GF14288
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF14288
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dana_GF14288
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dana_GF14288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 6497116
NCBI-ProteinID: XP_001962726
FlyBase: FBgn0091315
UniProt: B3MMQ6
Position
Unknown
AA seq 673 aa AA seqDB search
MSGCFRSNRKLTMAVSACVIIAVMALTVGLCVGLGSSDEVREDQPRFTIDHEANSFMLDG
EPFRYVSGSFHYFRAVPEAWRSRLRTMRASGLNALDTYVEWSLHNPHEDEYNWEGIADVV
KFLEIAQEEDFYIILRPGPYICAERDNGGLPHWLFKKYPSIKMRTNDPDYIAEVGKWYAQ
LMPRLQHLLVGNGGKIIMVQVENEYGDYACDHDYLNWLRDETEKYVSGKALLFTVDIPNE
KMSCGKIDNVFATTDFGIDRINEIDEIWKMLRVQQPTGPLVNSEFYPGWLTHWQEQNQRR
DGQVVADALKTILSYNASVNLYMFFGGTNFGFTAGANYDLDGGIGYAADITSYDYDAVMD
EAGGVTSKYDKVKAVIGEFLELPEITLNPAKRIAYGKVEVTPALALLSAEGRAALSKGDP
VESVKPKTFEELDQYSGLVLYETELPTMDLDPALLKVDQIHDRAHVFVDQELVGTLSREA
RIYSLPLSKGWGNTLQLLVENQGRINFYISNDTKGIFGDVSLQLHNGGYLPLENWRSTAF
PLDQASVELWRRERSVQKDLDSFLARQRILRNGPLVYTGTFTVGEVGDTYLNMAGWGKGV
AYVNGFNLGRYWPVAGPQVTLYVPNELLKVGENSVVILEYQRANKTTNGADLPAVQFDAV
AQLDGQCGDVTLK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgagcggttgttttcgctccaatcgtaaactgacaatggccgtgagtgcttgtgtgatc
atcgccgtgatggccctcaccgtcggcctatgtgtgggcctgggcagtagcgacgaagta
cgcgaggaccagcccaggttcaccatcgaccatgaggccaacagcttcatgctggacgga
gagccttttcgctatgtctctggatcattccactatttccgggcggtgccagaggcctgg
cgaagtcgattgcgaaccatgcgagcatccggtctcaatgcacttgatacctatgtggaa
tggtctcttcacaatccccacgaggacgagtacaactgggagggtattgctgatgtggtg
aagtttctggagattgcccaggaggaagacttctacattatcctacgcccaggaccatat
atatgtgccgaaagagataacggaggccttccccactggctctttaagaagtacccctct
attaaaatgcgaaccaacgatcccgactatatagccgaggtgggtaagtggtatgcccaa
ctaatgccacggctccagcacttgttggtcggcaacggaggcaaaataatcatggtccaa
gtggagaacgagtacggagactatgcctgtgaccacgactacttgaactggctgcgtgac
gagactgagaagtacgtgtctggcaaagccctactgttcacggtggacatccccaacgag
aaaatgagctgtggaaaaatagataacgtgttcgccaccacggactttggtatcgatcgc
attaatgaaattgacgaaatatggaaaatgctgcgagtccaacaacccactggcccgttg
gttaactctgagttctaccctggttggcttacccattggcaggagcagaaccaaaggcga
gatggccaggtggtagctgatgcattgaaaaccattctcagctataatgcgagcgtaaac
ttatacatgttcttcggtggaaccaactttggattcactgccggagccaactacgacttg
gacggagggattggttatgcagcggatatcaccagctatgactacgatgcagtgatggat
gaagccggtggggttacctccaaatacgacaaagtcaaggctgtgattggtgagttcctg
gagttgcccgagatcacgttgaatcctgccaagcgtatagcgtacgggaaagtggaagta
acacccgcactggccctgctctctgcagaaggaagagctgccctctcaaagggcgatcct
gtggagtcggtcaagcccaaaacattcgaggaattggaccaatactcgggactggtgctg
tacgaaacagagcttcctaccatggacctggacccggccctcctcaaggtggatcagatc
catgaccgcgcacacgtcttcgtcgaccaggaactggtgggcaccctatcccgcgaggcc
cggatctactcgctgccacttagtaaaggctggggcaacactctgcagctgctagtggaa
aaccagggtcggattaatttctacatttccaatgacacaaagggtattttcggcgacgtg
agcctgcagctacacaatggtggctacctaccgctggagaactggagaagtactgccttt
ccgctggaccaagcctctgtcgaactctggcgacgagagcgtagtgtccaaaaagacctg
gactcgttcctggccagacaacgcatcctgcgcaatggacccctcgtgtatacaggcacc
ttcacggtgggggaagtgggcgacacctacctgaacatggccggatggggcaagggagtg
gcctatgtaaacggcttcaatctggggcgctactggcctgtagccggtccccaggttacc
ttgtatgtgccgaacgaactcctcaaggtgggagagaactctgttgttatcctggagtac
cagcgcgccaataagacgacaaacggcgccgatctgcccgccgtgcagttcgatgcagtg
gctcaactggatggacagtgcggcgacgtcactctcaaataa

DBGET integrated database retrieval system