KEGG   Drosophila ananassae: Dana_GF14410Help
Entry
Dana_GF14410      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
dan  Drosophila ananassae
Pathway
dan00730  Thiamine metabolism
dan01100  Metabolic pathways
dan04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Dana_GF14410
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    Dana_GF14410
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dan03016]
    Dana_GF14410
   03029 Mitochondrial biogenesis [BR:dan03029]
    Dana_GF14410
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:dan02048]
    Dana_GF14410
Enzymes [BR:dan01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     Dana_GF14410
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    Dana_GF14410
 Prokaryotic type
    Dana_GF14410
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    Dana_GF14410
Prokaryotic defense system [BR:dan02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   Dana_GF14410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 6497235
NCBI-ProteinID: XP_001962507
FlyBase: FBgn0091437
UniProt: B3MLH9
Position
Unknown
AA seq 456 aa AA seqDB search
MQKVLGRIQAHILRTRSQNASVSMIRQESTKPAATSKEFRERQVRFNIKNEQTEGRPLYL
DAQATTPMDPRVLDAMLPFLTNYYGNPHSRTHAYGWETEQAVEKAREQVATLIGADPKEI
IFTSGATESNNISVKGVARFYGAKKRHVITTQTEHKCVLDSCRALENEGFKVTYLPVQVN
GIIDMKQLEETITPETSLVSIMTVNNEIGVKQPISEIGQLCRSRKVFFHTDAAQAVGKIP
LDVNAMNIDLMSISGHKIYGPKGVGALYVRRRPRVRLEPIQSGGGQERGLRSGTVPAPLA
VGLGAAAELALQEMDYDKKWVDFLSKRLLDRISSALPHVIRNGDPDATYNGCLNLSFAYV
EGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTIEEVDY
TADKCIKHVERLREMSPLWEMVQEGIDLKTIQWSQH
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagtgctgggccgtatacaggcgcacatcctgcgcacacgctctcaaaatgcc
agtgtttccatgattagacaggagtccacaaaaccggctgccacttcaaaagaatttcgt
gagcgccaggtgcgtttcaacattaaaaatgaacagaccgagggacgtccgctgtacttg
gatgcccaagctaccacaccgatggatccccgtgtcctggacgccatgctccccttcctt
accaactactacggcaacccacattcgcgtactcatgcctacggctgggagacagagcaa
gctgtggaaaaggcgcgcgaacaggttgccactttgatcggggctgatcccaaggagatc
atctttacctccggcgccacagaatcgaacaacatttccgtcaagggggtggcccgcttc
tatggagccaagaagcggcatgtaatcaccacgcagacagagcacaagtgtgttctggac
tcctgccgggcgctggagaacgagggtttcaaagtcacctacttgccggtgcaggtcaac
ggcatcatagacatgaaacagctggaggaaaccataacaccggaaacatcgctggtgtcc
attatgacggtgaacaatgagatcggagtgaagcagcctatcagcgagattggccaactt
tgtcgctcccgcaaagtattctttcacacggacgccgcccaggcggtgggaaagatcccg
ctcgatgtgaacgccatgaacatagacctgatgtccatttccgggcacaagatctatggc
cccaagggcgtgggtgccttgtatgtgcgtcgccgaccccgcgttcgtttggagcccatc
cagagcggtggtggacaggagcgtggcctgcgaagcggcactgttcccgctccactggct
gttggactaggagctgctgcagaattggctctacaggaaatggattacgacaagaagtgg
gtggactttttgtcgaaacgcctgctggacaggatatcaagtgccttgccacatgtaatt
aggaatggagaccccgatgccacctacaacggttgcttgaacttgtcgttcgcttatgtg
gagggagagtcccttctgatggccctgaaggatgtggcgctgagtagtggctccgcctgc
acttctgcctccctggagccctcctatgttctgagagccattggcaccgatgaggatctg
gcccacagctccattcgtttcggcattggacgcttcacaaccatcgaggaagtcgattac
acggccgacaagtgcatcaagcatgtggagcggttgcgtgaaatgtcgcccctgtgggag
atggtccaggagggcatcgaccttaagaccatacaatggtcccagcactaa

DBGET integrated database retrieval system