KEGG   Drosophila ananassae: Dana_GF14725Help
Entry
Dana_GF14725      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dan01009]
    Dana_GF14725
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     Dana_GF14725
Protein phosphatases and associated proteins [BR:dan01009]
 HAD phosphatases
  Other HAD phosphatases
   Dana_GF14725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase HAD Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 6497545
NCBI-ProteinID: XP_001961858
FlyBase: FBgn0091752
UniProt: B3MNC2
Position
Unknown
AA seq 240 aa AA seqDB search
MASCRCYCPVTHVIFDCDGTLMNTESLYMKIAIETLAPFGKTYTLEDQARYLGKSSSVVA
REIVEDFNLPITAEEYHKSYRQSNYTYMKDVKLLPGVKDFILHLHEFRIPIAIATGSISE
MIALKFQSHPDIKNAFHHIVCGNDPELGPDRGKPEPDIYLLAASRFHPPADPRKCLVFED
SPVGLRSGQAAGMQVVFIPESENSRARGEDPTMVLRSMTEFQPELFGLPAYPNCSKFEFG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctgtcggtgttactgcccagtcacccatgtcatctttgactgcgatggaacc
ttaatgaacaccgagagcctgtatatgaagattgcgatcgagaccttggctccttttggt
aaaacctacactttggaggatcaggcacgatacttgggaaaatcgtcttctgtagttgcc
agggaaattgtcgaagattttaatcttccgatcacggcagaggagtaccacaagtcatac
agacaatcaaactatacatacatgaaagatgttaagcttctgcctggtgttaaggacttc
atcctccacttgcacgaattccgaatacccatcgctattgccaccggctctatcagcgaa
atgatcgccctaaagtttcaatcccacccggatatcaaaaatgccttccatcacatagtg
tgtggcaatgatccggagctggggccggacagaggcaagccggagccggatatctatcta
ctggcggcctcccgcttccaccctccagcagatcccaggaagtgtctggttttcgaggat
tcgccagttggcttaagatccggacaagcagccggcatgcaggttgtgttcatacccgaa
agtgaaaactcccgggcaaggggagaggatcctacgatggtgctgagatccatgacagag
ttccagcccgaactttttggactgcctgcttatcccaactgttccaaatttgagttcggc
tga

DBGET integrated database retrieval system