KEGG   Drosophila ananassae: Dana_GF15955Help
Entry
Dana_GF15955      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Dana_GF15955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-GeneID: 6498756
NCBI-ProteinID: XP_001967266
FlyBase: FBgn0092978
UniProt: B3N131
Position
Unknown
AA seq 179 aa AA seqDB search
MQYRACARFLPSSWVFARNLLTVASSTAFVTSCSSFADTRPFAGISASKMSSNAKTCKSS
CPGTPYQAGSSSVAYVTTPDQESAKKLARGIIERKLAACVNIVPQIESIYMWEGKVNEDS
EYLLMIKTRTQQVDELSKYVRENHPYSVAEVISLPIQNGNPPYLKWIEQTVPDKPENKD
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcgggcctgtgcaaggttcttgccctctagctgggtattcgcacgcaacctg
ttaactgtcgccagcagcaccgcattcgtcacaagctgttcgtctttcgccgacaccaga
ccttttgccggaatctccgcttccaagatgagcagcaacgccaagacctgtaaatcgtcg
tgccccggaacaccataccaagcaggtagcagctcagtggcatatgtgaccaccccggac
caggagtcggccaagaagctagcccgcggcatcatcgagaggaaactggccgcttgcgtc
aacattgtgccgcagatcgagtccatatacatgtgggagggcaaggtcaacgaagacagc
gagtacctgctgatgatcaagacgcgcacccagcaagtcgacgagttgagcaagtacgtc
cgggagaatcatccgtacagcgttgctgaggtcatctccttgcctatccagaatggtaat
ccgccatacttgaagtggatcgagcagacagtgccggataagccagagaataaagactaa

DBGET integrated database retrieval system