KEGG   Drosophila ananassae: Dana_GF16201Help
Entry
Dana_GF16201      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dan  Drosophila ananassae
Pathway
dan00010  Glycolysis / Gluconeogenesis
dan00051  Fructose and mannose metabolism
dan00562  Inositol phosphate metabolism
dan01100  Metabolic pathways
dan01200  Carbon metabolism
dan01230  Biosynthesis of amino acids
Module
dan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dan_M00002  Glycolysis, core module involving three-carbon compounds
dan_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dana_GF16201
   00051 Fructose and mannose metabolism
    Dana_GF16201
   00562 Inositol phosphate metabolism
    Dana_GF16201
Enzymes [BR:dan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Dana_GF16201
Exosome [BR:dan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Dana_GF16201
  Exosomal proteins of bladder cancer cells
   Dana_GF16201
  Exosomal proteins of melanoma cells
   Dana_GF16201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 6498998
NCBI-ProteinID: XP_001955540
FlyBase: FBgn0093223
UniProt: B3LZC2
Position
Unknown
AA seq 366 aa AA seqDB search
MSPNWILKLEKIVEDLALRRLAMKSLQTTLIHKVNFGRVISITLRQPLKNQYHWSTTMDM
NQPTVGGLTVDVVKGVVSQAFLGKFTAVFPKLFKCQWKTYEGQKKFYANFSTDCNESNMS
GRKFCVGGNWKMNGDQKSIADICKTLSSAPLDPNTEVVIGCPAIYLMYARNLLPCEVGLA
GQNAYKVEKGAFTGEISPAMLKDIGADWVILGHSERRAIFKESDELIAEKAQHALDQGLK
VIACIGETLEEREAGKTNEVVARQMCAYAQKIKDWQNVVVAYEPVWAIGTGKTATPDQAQ
EVHAFLRQWLSDNISKDVSASLRIQYGGSVTAANAKELAKKPDIDGFLVGGASLKPEFVE
IINARQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccaactggattctaaaacttgaaaaaatcgtcgaggatttggctctccgtcgg
ctagccatgaaatcattgcaaactacattgattcacaaagtcaacttcgggagagtcata
agtataacattgcggcaaccactaaagaaccagtaccactggagcaccaccatggacatg
aaccagcccaccgttggagggttgacggtggatgtggtgaagggggtggtgtcgcaagct
tttctcggcaagttcacagctgtttttccaaagcttttcaagtgccagtggaagacttat
gaaggtcagaagaagttttacgccaatttcagtaccgactgcaacgagagcaacatgagc
ggccgcaaattctgtgtgggaggcaactggaagatgaacggcgaccagaagtccatcgcc
gacatctgcaagaccctgagctccgctcccttggaccccaacaccgaggtggtcatcggc
tgccccgccatctacctgatgtacgcccgcaatctgctgccctgcgaggtgggtctggcc
ggccagaacgcctacaaggtggagaagggtgccttcaccggtgagatctcgcccgccatg
ttgaaggacatcggagctgattgggtcatcctgggtcactcggagcgtcgcgccatcttc
aaggagtccgatgagctgatcgccgagaaggcccagcacgccctggaccagggactcaag
gttattgcctgcattggcgagaccctggaggagcgcgaggccggcaagaccaacgaggtg
gtggcccgccagatgtgcgcctacgcccagaagatcaaggactggcaaaacgtggtggtg
gcctacgagcccgtctgggccattggcaccggcaagactgccactcccgaccaggcccaa
gaggttcacgccttcctgcgccagtggctgagcgacaacatctccaaggacgtctccgcc
agcttgcgcatccagtacggtggctcggttaccgccgccaatgccaaggagctggccaag
aagcccgacattgatggtttcctggttggaggtgcttcgctgaagcccgagtttgtggag
atcatcaatgccagacagtaa

DBGET integrated database retrieval system