KEGG   Drosophila ananassae: Dana_GF16253Help
Entry
Dana_GF16253      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
dan  Drosophila ananassae
Pathway
dan00511  Other glycan degradation
dan00600  Sphingolipid metabolism
dan01100  Metabolic pathways
dan04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dana_GF16253
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dana_GF16253
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Dana_GF16253
Enzymes [BR:dan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Dana_GF16253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 6499050
NCBI-ProteinID: XP_001955407
FlyBase: FBgn0093275
UniProt: B3LY64
Position
Unknown
AA seq 558 aa AA seqDB search
MLATRGSLVLGFLLLSAIGGNFESIPCKLRDAEHGKVCVCTADYCDYLENPTIADDSDFA
LISSSKQGLRFATSRGKFGTEEVYTVEDYVEPTPEAVNETVLSRLMDRVVARAFTLETRE
SSITRSVTLQLDRSKTHQKMVGFGGSYTGAVTYLVENFKDPELADHLYKSFYAEDGIGFN
LMRISIGGCDFDLDAWSYAEEEGDTLLSDMDQLDERDVERVAQIKRLIEVSGVKNLLIKG
AAWSAPPWMKTNNRWTGFGRLKRDYYQTWADYHLQWIKLMEDNGLPIWAISTGNEPLNGI
FFMYFVKFMSMGWTPWTQAIWLNDHLGPTIRNSEFKDIVIFGNDDQRYSFPWWFQRMNKT
RPNSVDYLDGLSLHWYWDEIFGSSFIDNTREYAPDKILIVSESCIGDKPWQAAAPLLGSW
ERAEKYARDYLANIKLGFHGWIDWNICLDEEGGPNYVDNTVDAPVIANTTTFEEFYKQPM
FYAIGHFSKLVPEGSIRIDAIPSNVNLNTVAFLRPDNKIAAVLFNSGRADLDITVVDSLR
GKFIVNVPAKSIHTLLYN
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgttggccaccagaggatctctggtgcttggattcctgctgctatcagcaattggtggg
aattttgagtcgatcccctgcaaactgagggacgcggaacatggcaaggtgtgtgtttgc
acggcggactactgcgactacctggagaatcccacgatagccgacgattccgacttcgcc
ttgatttccagctcgaagcagggacttcgatttgccacatccaggggaaagtttggcaca
gaagaggtgtataccgtcgaggattatgtggagcccacgccagaggctgtgaatgaaact
gtcctgtcccgtctgatggatcgggtggtggcccgtgccttcaccctggagacccgggag
agctccatcactcgttcggttaccctgcagctggaccgaagcaagacccaccagaagatg
gtgggtttcggcggcagttacaccggtgctgtgacctatctggtggaaaacttcaaggat
cccgagctcgccgatcatctctacaagtccttctacgccgaggatggtatcggcttcaac
ctcatgcgcatttccattggcggttgtgactttgatctggacgcctggtcttatgccgag
gaggagggcgacactctgctctccgacatggatcagctggatgagcgggatgtggagcgt
gttgctcagattaagcgcctcatcgaggtctccggggtgaagaaccttttgatcaaagga
gccgcctggagcgctccgccatggatgaagacgaacaataggtggacaggattcggtcgc
ctaaagcgggactactaccagacctgggcggactaccaccttcaatggataaagctgatg
gaggacaatggactccccatctgggccatctccaccggaaacgagcccctcaatggaatc
ttcttcatgtactttgtaaagttcatgagcatgggctggactccatggactcaggctatt
tggctaaatgatcatctgggtcctaccatccgaaactctgagtttaaggacattgttatt
tttggcaacgacgatcagcgctactccttcccttggtggttccagaggatgaacaagacc
cgcccgaactcggttgattatctggacggattatcgctgcactggtattgggatgaaata
tttggcagcagctttatcgataacaccagggagtatgcccccgacaagatcttgatcgtt
tccgagtcctgcattggggataagccctggcaggcggctgctcctcttctgggcagttgg
gagagggccgagaagtacgcccgggattacttggccaacataaaattgggattccatggt
tggatcgactggaacatatgcttggatgaagagggcggtccaaactatgtagataacacg
gtagatgccccggtgattgccaatactacaacctttgaggaattctacaaacagcccatg
ttctatgccattggacacttttcgaaactggttcccgaaggctctattcgcattgatgcc
attcccagtaacgtaaacctgaacaccgttgcttttctccgtccggacaacaaaatagcc
gcagtcttgttcaacagcggacgtgctgatctcgatattaccgtggtggacagtttgagg
ggcaagttcattgtcaatgttcccgccaaatccattcacacattgctgtacaactga

DBGET integrated database retrieval system