KEGG   Drosophila ananassae: Dana_GF16323Help
Entry
Dana_GF16323      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K17890  autophagy-related protein 16-1
Organism
dan  Drosophila ananassae
Pathway
dan04136  Autophagy - other
dan04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dan00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Dana_GF16323
   04136 Autophagy - other
    Dana_GF16323
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dan04131]
    Dana_GF16323
   03029 Mitochondrial biogenesis [BR:dan03029]
    Dana_GF16323
Membrane trafficking [BR:dan04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    Dana_GF16323
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    Dana_GF16323
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    Dana_GF16323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 WD40_like kleA_kleC
Motif
Other DBs
NCBI-GeneID: 6499119
NCBI-ProteinID: XP_001955261
FlyBase: FBgn0093344
UniProt: B3LWY3
Position
Unknown
AA seq 606 aa AA seqDB search
MSTEEHVWRAHVVRRLRERNRKECDNFKEIIEQNNRLIDHVAQLKADNLKLSVENEQLRS
AVSTGGTGSNVAIATLEKKLLAQQEELTELHKRKGENSQLIVDLNLKVEQQRTIIAEKEH
SLADQQTNNNRLRAEVQLLHSSLEELKKLNNTMLDEHTALQLAFSSLEDKLRGVQDENRC
LLDRLMRYKSKDADKLNEENESIIRKRSAKLKRDLEDAVREPSSSSNISPTPGPTPMQRT
STSPAQFVGGIIGGDDDFDEATINGAMEAIGLDDNEYISARFTAGEVTENTRASIDALKS
TGYLGQANPTKILMKFEAHENESHAVRWSPVERMVATGGADRKVKLWDIGKNSTEPRAVL
SGSSAGINSVDFDSTGAYILGTSNDYGARVWTVMDNRLRHTLTGHSGKVMAAKYVHEPIK
VVTGSHDRTLKIWDLRSIACIETKFAGSSCNDLVTTDSLGSTIISGHYDKKIRFWDIRTE
KQADDVLMPAKITSLDLSKDCNYLICSVRDDTIKLLDLRKNQVISTFTNEHFKISCDFAR
ASFNPSGLKIACGSADGAIYIWNVNGFLEATLKGHSTAVNAVSWSPNNNMLASVGKHKRC
IIYSDS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgtctacggaagaacatgtgtggcgagcgcatgttgtcagacgattacgcgaacgcaat
cgcaaggaatgcgataatttcaaggaaatcatagaacaaaacaaccgattaattgaccat
gtcgcccagctgaaagcggacaacctgaagctgtccgtggaaaacgagcagctacgcagt
gcggtgtcaacaggtggtaccggctctaatgtagccattgccacgctagagaagaagctg
ctcgcccagcaggaagagctcacggagctgcataagcgaaagggtgaaaactcccagtta
atcgtcgacttaaacctgaaagtggagcaacaaagaacaatcattgcagagaaggaacac
agccttgccgaccagcaaaccaataacaatcggctgcgggccgaagtgcagctacttcac
tccagcttggaggaactcaagaagctaaacaacaccatgctggatgagcatacggctttg
caattggcatttagctcactcgaggataaattgcggggcgtccaagatgaaaatcgctgt
ttgctcgaccgtctgatgcgatacaagtcgaaggatgctgacaagttgaacgaggagaac
gagagcatcataaggaaacgttcggccaaactgaaacgagacctcgaggacgccgtacga
gagcccagctcttcgagcaatatttcacccacgccgggaccaacgcctatgcaacgaacc
tccacgagtcctgctcagttcgttggcggcattatcggcggtgacgacgatttcgacgag
gctacaattaatggcgccatggaggctataggcctcgatgataatgaatatattagcgct
cgttttacagccggcgaagttactgagaacacccgggcttccattgatgctctaaagtca
acaggttatttgggtcaggcgaatccgacaaagatacttatgaaattcgaggcccacgaa
aacgaatcgcatgcggtgcgctggagtcccgtggagcggatggtggctacaggtggcgcc
gatcgcaaagtcaagctgtgggatatagggaaaaattcaaccgagccccgcgcagttctg
agcgggagcagcgctggcattaattccgtggattttgactctacaggggcgtatattcta
ggtacttcaaacgattatggtgccagggtttggacggtaatggacaatcggttgaggcac
acgctgacgggtcacagtggaaaagtaatggctgccaaatacgtccacgagcccattaaa
gtggtgaccggaagtcatgatcgtaccttaaagatttgggatctgcgcagcattgcttgt
atagaaacgaaatttgctggatcaagctgcaacgatctcgtcaccactgatagcttgggt
tccacgatcattagcgggcattatgataagaaaatccgattctgggacatacgaacagag
aaacaggcagacgatgtccttatgccggctaaaatcacctcgctggacttgtcaaaagat
tgcaattacctcatatgctctgtaagagatgatactattaaattattagatttacgcaaa
aatcaagttatatccacgtttacaaatgaacactttaaaatcagctgtgattttgctcgg
gcctccttcaacccgagcggcttgaagatcgcttgtggatcggcggatggcgcaatatac
atttggaatgtaaatggtttcctagaagccacgctcaagggacacagcacggcggtgaac
gcagtcagttggtcgcccaacaacaatatgctggcttctgtcggaaagcacaagcgatgc
atcatctactcggattcgtag

DBGET integrated database retrieval system