KEGG   Drosophila ananassae: Dana_GF17319Help
Entry
Dana_GF17319      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K22823  non-structural maintenance of chromosomes element 3
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dan03400]
    Dana_GF17319
DNA repair and recombination proteins [BR:dan03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    SMC5-SMC6 complex
     Dana_GF17319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAGE
Motif
Other DBs
NCBI-GeneID: 6500104
NCBI-ProteinID: XP_001953219
FlyBase: FBgn0094337
UniProt: B3LYD9
Position
Unknown
AA seq 234 aa AA seqDB search
MASTSRAARSQNGNLWEPDGSQPITEIDDKVRGILNYILDHSAEKIPIKEKDILATVGDK
RDLVRRLPLVGNLLARKFGIILKPIDASGKTFICTAETPMASIHELTPAQRPQYTLLYLI
LMYIFLRGNRIEDTKLYGMLEMLNIVVDEEHGYFGPNIRKLIEETFVKQQYLKRERSQLS
AYDDAKVYFLWGLRSKAEFSYEQVVQFASRLFNQNPINFDSHLKMAKDLDNQED
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctagcacatctcgcgctgctagaagccaaaatgggaacctatgggagccagacggc
tcgcagcccattactgaaatagacgacaaagtgcgcggaattttgaactatatcctggat
cactcggcggaaaagattcccatcaaggaaaaggacatactcgccactgttggagacaaa
agggatctggtacgccgcctgccactggtgggtaatttgctggccagaaaatttggcata
atattgaaaccgatcgatgcctccgggaagacgtttatttgcactgcggagacaccgatg
gcctccattcacgaactgactcctgcccagcggccacagtatacgcttctatatctcatc
ctcatgtacatctttttgcgcggcaaccgcatcgaagacacgaaactgtacggcatgctg
gagatgctgaacatcgttgtcgatgaggaacatggatactttggacccaacattcggaag
ctgatcgaggagactttcgttaagcagcagtacctgaagcgagaacgctcccagctgagt
gcctacgacgacgccaaggtctacttcctctggggcttgcggtctaaagccgagttctct
tacgaacaagtcgtccagtttgcgtccagacttttcaatcagaatcctattaacttcgac
tcccacctaaagatggccaaagatctggacaaccaggaggattaa

DBGET integrated database retrieval system