KEGG   Drosophila ananassae: Dana_GF17404Help
Entry
Dana_GF17404      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K17610  calcineurin B homologous protein 1
Organism
dan  Drosophila ananassae
Brite
Protein phosphatases and associated proteins [BR:dan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Dana_GF17404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RE_XamI
Motif
Other DBs
NCBI-GeneID: 6500188
NCBI-ProteinID: XP_001953053
FlyBase: FBgn0094422
UniProt: B3LWP2
Position
Unknown
AA seq 189 aa AA seqDB search
MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAIN
PLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDD
DGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVD
QKMSIRFLN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataaatcttcgctgttcctgcgtaacgaggaaatcgctcaaatccaggaggaa
actggctttacccccaaccaaatcgagcgactgtactcccgtttcacttccctggatcgc
aacgactgcggcactttgtcccgggaggaccttatgcgcattcctgagctggcgatcaac
ccgttgtgcgagaggatagtgcactccttcttcgcggaaagcaatgacgaccgggtcaac
ttccggcagtttatgaacgtcctggcccatttccgaccgctgagggacaacaagcagagc
aagctgaacagccgcgaggagaagctgaagttcgcctttaagatgtacgatctggacgat
gatggtgtgatcagtcgggacgagctgctctccattctgcatatgatggtgggggcgaac
atcagccaggaccagttggtgagcattgccgagaggacgattctggaggcggatttgtgt
tgccagggcaagatctcgttcgaggacttctgcaaggcgctggaccgcaccgatgtcgac
cagaagatgtccatcaggtttctcaactaa

DBGET integrated database retrieval system