KEGG   Drosophila ananassae: Dana_GF17623Help
Entry
Dana_GF17623      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K00248  butyryl-CoA dehydrogenase [EC:1.3.8.1]
Organism
dan  Drosophila ananassae
Pathway
dan00071  Fatty acid degradation
dan00280  Valine, leucine and isoleucine degradation
dan00410  beta-Alanine metabolism
dan00640  Propanoate metabolism
dan00650  Butanoate metabolism
dan01100  Metabolic pathways
dan01200  Carbon metabolism
dan01212  Fatty acid metabolism
Module
dan_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Dana_GF17623
   00650 Butanoate metabolism
    Dana_GF17623
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dana_GF17623
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dana_GF17623
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dana_GF17623
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.1  short-chain acyl-CoA dehydrogenase
     Dana_GF17623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 6500407
NCBI-ProteinID: XP_001953152
FlyBase: FBgn0094641
UniProt: B3LXS8
Position
Unknown
AA seq 405 aa AA seqDB search
MQSVIARSLNIVRRSANLRQIASLSALPDTHQMLQKTCRDFANAELSANAAKCDREHLYP
EKLIRQMGELGTMAVAIPEELGGTGLDYLAYAIAMEEISRGCASAGVIMSVNNSLYLGPL
LSFGNDSQKETYITPYTTGKRVGCFALSEPGNGSDAGAASTIATDKGDHFLLNGTKAWIT
NAFEAEAAIVFATTNKQLKHKGISAFIVPKGLKGFSLGKKEDKLGIRGSSTCQLIFEDCA
IPKESMLGEPGFGFKIAMQTLDAGRIGIAGQALGIGQAALELAVDYSQKRQAFGKPISKL
QSIQQKIADMSLAMESARLLTWRAAWLKDNKQPYTKEAAMAKLAASEAATMCAHQCIQIL
GGMGYVTDMAAERHYRDARITEIYEGTSEIQRLVIAGSILKEYAS
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctgtaattgcccgttccctaaacatcgttcgcagatcggcgaatctccgccag
attgcgtctttgtcggcccttccggacacccatcagatgttacaaaagacctgccgggac
ttcgccaacgctgagttgagtgccaacgctgcgaaatgcgatcgggagcacctgtatcct
gaaaaactgatccgtcaaatgggagaacttggcaccatggctgtggcgattccagaggag
ttaggtggtaccggtcttgattacttggcctatgcgattgccatggaagagatctcaagg
ggatgcgcctctgctggcgtgatcatgtcggtaaacaactccctctacttgggacctcta
ctgtcctttggaaatgatagccaaaaggagacttacatcacaccctacacaaccgggaaa
cgagtgggatgctttgctttatcggagccgggaaatggttcagatgctggagctgcttct
accatagctaccgataagggagatcacttcttactaaatggaaccaaggcgtggatcacg
aatgcatttgaggctgaggccgctattgtttttgccaccaccaacaagcagttgaagcac
aagggcatctccgctttcatagtccccaagggcttgaagggcttctccttgggtaagaaa
gaggacaagctgggcatccgaggatcatcaacctgccagctgatattcgaggattgcgcg
atacccaaggagagcatgctgggagagcccggctttggattcaaaattgccatgcagacc
ctagatgctggaaggataggcatcgctggacaagcgctgggaatcggtcaggctgctttg
gagcttgccgtggattactcgcagaaacgacaggcattcgggaaacccatctcgaaattg
caatctattcagcaaaagattgccgacatgtcgttggccatggaatcagcccgccttctt
acctggcgcgccgcttggctaaaggacaacaagcagccatacaccaaggaggccgctatg
gccaagcttgctgcttcggaggcagccaccatgtgtgcccaccagtgcattcagatcctc
ggtggaatgggatacgttacggatatggcagcagagcggcactatcgcgatgctcggatc
acggagatctatgagggcacctccgagattcaacggcttgtcattgctggttcgatactc
aaggaatacgccagttaa

DBGET integrated database retrieval system