KEGG   Drosophila ananassae: Dana_GF18385Help
Entry
Dana_GF18385      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dan  Drosophila ananassae
Pathway
dan03040  Spliceosome
dan04141  Protein processing in endoplasmic reticulum
dan04144  Endocytosis
dan04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    Dana_GF18385
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Dana_GF18385
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    Dana_GF18385
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    Dana_GF18385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dan01009]
    Dana_GF18385
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dan03041]
    Dana_GF18385
   03009 Ribosome biogenesis [BR:dan03009]
    Dana_GF18385
   03110 Chaperones and folding catalysts [BR:dan03110]
    Dana_GF18385
   04131 Membrane trafficking [BR:dan04131]
    Dana_GF18385
   03051 Proteasome [BR:dan03051]
    Dana_GF18385
   03029 Mitochondrial biogenesis [BR:dan03029]
    Dana_GF18385
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dan04147]
    Dana_GF18385
Protein phosphatases and associated proteins [BR:dan01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     Dana_GF18385
Spliceosome [BR:dan03041]
 Complex B
  Other components
   Prp19 complex
    Dana_GF18385
 Complex C
   Prp19-CDC5 complex
    Dana_GF18385
Ribosome biogenesis [BR:dan03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    Dana_GF18385
Chaperones and folding catalysts [BR:dan03110]
 Heat shock proteins
  HSP70 / DNAK
   Dana_GF18385
Membrane trafficking [BR:dan04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    Dana_GF18385
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    Dana_GF18385
Proteasome [BR:dan03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    Dana_GF18385
Mitochondrial biogenesis [BR:dan03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    Dana_GF18385
Exosome [BR:dan04147]
 Exosomal proteins
  Proteins found in most exosomes
   Dana_GF18385
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DUF4795 Hydantoinase_A StbA HORMA
Motif
Other DBs
NCBI-GeneID: 6501160
NCBI-ProteinID: XP_001954666
FlyBase: FBgn0095403
UniProt: B3M0Z4
Position
Unknown
AA seq 644 aa AA seqDB search
MPAIGIDLGTTYSCVGVYQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNP
RNTVFDAKRLIGRKYDDPKIAEDIKHWPFKVVSDGGKPKIGVEFKGEPKRFAPEEISSMV
LVKMKETAEAYLGETVSDAVITVPAYFNDSQRQATKDAGRIAGLNVLRIINEPTAAALAY
GLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSLFEVRATAGDTHLGGEDFDNRLVTHLA
EEFKRKFKKDLRSNPRALRRLRTAAERAKRTLSSSTEATIEIDALFEGHDFYTKVSRARF
EELCADLFRNTLQPVEKALTDAKMDKGQIHDIVLVGGSTRIPKVQSLLQQFFHGKSLNLS
INPDEAVAYGAAVQAAILSGDQTGKIQDVLLVDVAPLSLGIETAGGVMTKLIERNCRIPC
KQTKTFSTYADNQPGVSIQVYEGERAMTKDNNALGTFDLSGIPPAPRGVPQIEVTFDMDA
NGILNVTAKEMSTGKAKNITIKNDKGRLSQAEIDRMVNEAERYADEDEKQRQRISSRNSL
ESYVFNVKQAVEQAGSDKLSEADKSSVLDKCNESIRWLDTNTTAEKEEFDHKLEELTRHC
SPIMTKMHQQSAGAAGAPGGPGAGCGQQAGGFGGYSGPTVEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccattggaatcgatctgggcaccacgtactcctgcgtgggagtctaccagcac
ggcaaggtggagatcatcgccaacgaccagggcaaccggaccacgcccagctacgtggcc
ttcacagaatccgagcgcctgatcggagacgccgccaagaaccaggtggcgatgaatccc
cggaacacagtcttcgacgccaagcgcctgatcgggcgcaagtacgacgaccccaagatc
gcagaggacatcaagcactggcccttcaaggtggtcagcgatgggggaaagccaaagatc
ggcgtggagttcaagggtgagccgaagcggttcgcccccgaggagatcagctccatggtg
ctggtcaagatgaaggagactgccgaggcgtacctgggcgagaccgtcagcgacgcagtg
atcacggttcccgcctacttcaacgattcgcagcgccaggccaccaaggacgccggccgc
atcgccgggctcaatgtgctccgcatcatcaacgagcccactgccgcagccctggcctac
ggactggacaagaacctgaagggagagcgcaacgtgctcatcttcgacttgggcggcggc
accttcgatgtctccatcctgactatcgacgagggatccctgtttgaggtgcgggccact
gccggagacactcacctgggcggcgaggacttcgacaacaggctggtcacgcacctggcg
gaggagttcaagcgaaagttcaagaaggacctgcgctccaacccgcgcgccttgagacgc
ctccgcacagctgccgagcgggccaagcgcaccctttcctccagcacagaggccaccatc
gagatcgacgcgctgttcgagggccacgacttctacaccaaggtgagccgtgcccgcttc
gaggagctttgcgcggacctcttccgcaacaccctgcagcccgtggagaaggccctgacc
gacgccaagatggacaagggccagatccacgacatcgtcctcgtgggaggctccacccgc
attcccaaggtgcagagcctgctgcagcagttcttccacggcaagagcctgaacctctcc
atcaaccctgacgaggctgtcgcctacggagcagctgtccaggctgcgatcctcagtggc
gaccagaccggcaagatccaggacgtgctgctggtggacgtggcaccactctcgctagga
atcgagaccgccggcggcgtcatgacgaagctcattgagcgcaactgccgcatcccgtgc
aagcagaccaagaccttctccacgtacgccgacaaccagcctggagtctctatccaggtg
tacgagggcgagcgcgcgatgaccaaggacaacaatgctctgggcaccttcgacctgtcc
ggcattccgcctgctcccagaggagtgccccagatcgaggtcaccttcgacatggacgcc
aacggcatactgaacgtcaccgccaaggagatgagcacgggcaaggccaagaacatcacc
atcaagaacgacaagggacggctgtcgcaggccgagatcgaccgcatggtgaacgaggcg
gagaggtacgccgacgaggacgagaagcagcgccagcgcatctcctcccgcaacagcctg
gagagctacgtcttcaacgtgaagcaggcggtggagcaggccggctccgacaagctaagc
gaggccgacaagtcgtcggtcctggacaagtgcaacgagtccattcgctggctggacacc
aacacaaccgccgagaaggaggagttcgaccacaagctggaggagctcacccgccactgc
tctcccatcatgaccaagatgcaccagcaatccgcaggagcggccggtgctccgggaggt
cctggagccggctgtggacagcaggctggaggatttggtggatactcgggacccaccgtc
gaggaggttgactaa

DBGET integrated database retrieval system