KEGG   Drosophila ananassae: Dana_GF18774Help
Entry
Dana_GF18774      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dan  Drosophila ananassae
Pathway
dan00450  Selenocompound metabolism
dan00970  Aminoacyl-tRNA biosynthesis
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Dana_GF18774
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dana_GF18774
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dan01007]
    Dana_GF18774
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dan03016]
    Dana_GF18774
Enzymes [BR:dan01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Dana_GF18774
Amino acid related enzymes [BR:dan01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Dana_GF18774
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dana_GF18774
 Prokaryotic type
   Other AARSs
    Dana_GF18774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 6501544
NCBI-ProteinID: XP_001955453
FlyBase: FBgn0095791
UniProt: B3LYB0
Position
Unknown
AA seq 573 aa AA seqDB search
MLIRRIKCLGYLGARYNSSHFVTTPIFYVNAAPHIGHLYSAVIADAHCRYQRLKYPERKV
RLCTGTDEHGTKIQQAAALHKVPVATYCDQISERYREVFQNANILQDDFIRTTEERHKRA
VAHFWRTLNSRGHIYSAAYSGWYCVSDETFLTDSQLKLDEATGARYSLESGHPVEWTEET
NYMFRLSKFQDDVIHWVKQEARIRPAKFEKILLDTLSEPLPDVSVSRPSNRVHWAIPVPD
DSSQTVYVWLDALVNYLSALGYPDEEYSAFWPPAQQIIGKDILKFHGIYWPAFLIAAGLQ
PPGQLYVHSHWTVDGQKMSKSKQNVVNPVQAAEQYTMEGLRYFLLREGVAHSDGNYSHVK
ALRILNSELADTLGNLLSRACAKTLNPRQIYPSAQAEHLAEILGSLDAAKRLQESLLQLS
ERCAQHYESNHFHLVADTAMATLHAANNFFETSRPWELKKGAAGSNEPRLETIIAMTMDA
LRLCGIVLQPIIPQLATRLLDKLSVPATQRGWNYLAESFANTAHHGGSRQLNEQSSAMLF
QRILEENREKEERKPQPAKRSKAKKKERRETMS
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgttaataagaagaattaagtgcctcggatatctgggagctcgctacaacagttcgcac
tttgtgacaacacccattttctatgtaaatgcagctccccacattggccacttgtactcg
gcggtgattgccgatgcccactgccggtaccagagactaaagtatccggagaggaaggtc
cggctttgtacgggaaccgatgagcacgggaccaaaatccaacaggcggcggcacttcat
aaggttccggtggccacatactgtgaccagatttcagaacgctaccgggaggtgttccag
aatgccaacatactgcaggatgatttcatacgcaccacggaagagcgccacaagcgagca
gtggctcatttttggcgcaccctgaactcccgtggacacatctactcggctgcctacagc
ggctggtactgcgtttccgatgaaaccttcctgaccgactcccaactgaagttggacgag
gctacgggtgctcgctactccctggaatctggccatcccgtggagtggacggaggagacc
aattatatgtttcgtctctccaagtttcaagacgatgtgattcactgggtgaagcaggag
gctcgcatccgcccggccaagttcgaaaagatcctactggacacactgagtgaacccctg
ccggatgtgtctgtctccagaccctcgaatagggtccactgggccataccggtgccggat
gactcctcgcagacggtctacgtttggctggatgcgttggtcaactacctcagtgccttg
gggtatcccgacgaggagtactccgccttctggccaccggcacagcagataatcggcaag
gatatcctcaagtttcacggcatttattggccagcattcctcatagccgccggcctccaa
cctcctgggcagctgtacgtccactcgcactggaccgtcgacggacagaagatgtcgaag
agcaaacagaatgtggtcaatcctgtccaggcagccgagcagtacacgatggagggtttg
cgatactttctactgcgtgagggcgtggcccacagcgacggcaactacagccacgtgaag
gcactgcgcatccttaactcggagctggcagacactttgggcaatctgctgtcccgtgcc
tgcgccaagaccctcaatccccgccaaatctatccgtcagcccaggccgagcatttggcg
gagatccttgggagcctggatgcggccaagcgcctgcaggagtcgctgctgcagctgtca
gaacgatgcgctcaacattacgagagcaatcacttccacttggtggccgacactgcaatg
gcgactctgcatgcggccaacaacttcttcgagaccagccggccctgggagctgaagaaa
ggagcggcgggcagcaacgagccgcgcttggagaccataatcgccatgacaatggacgca
ctgcgactctgcggcattgtcctgcagcccataattccccagctggccacgcggctgctc
gataagctcagtgtccccgcaacgcaacgtggctggaattatttggccgagagctttgcc
aacaccgcccaccatggcggcagtcgtcagttgaatgagcagagcagtgcgatgttgttc
cagcggattcttgaggagaatcgggagaaggaggagcgcaaaccgcaaccagccaagcgg
agtaaagccaagaaaaaggagcgccgcgaaacaatgtcctga

DBGET integrated database retrieval system