KEGG   Drosophila ananassae: Dana_GF19463Help
Entry
Dana_GF19463      CDS       T01059                                 

Gene name
Dana_lyso
Definition
(RefSeq) lyso, isoform A
  KO
K13278  60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
dan  Drosophila ananassae
Brite
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dana_GF19463 (Dana_lyso)
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     Dana_GF19463 (Dana_lyso)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Dana_GF19463 (Dana_lyso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asparaginase Ank_2 Ank_3 Ank_4 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 6507968
NCBI-ProteinID: XP_001966005
FlyBase: FBgn0062827
UniProt: B3MXE9
Position
Unknown
AA seq 655 aa AA seqDB search
MSANGGDAPAHPPHETLASKPIDISVRLPSSLHERLTSLDKGMPPASPTLPSPTIRRNKS
DGKLMAQDIKEARVKVIYTGGTIGMMRNERSVLAPIPNALVRHIRKYPNIHDEEYALQRF
GASASMAPLVLPLVQGVDRRILYQITEYTPLLDSSNMTMNDWARIASDIQQSYEFFDGFV
VLHGTDTLSYTASALSFMLENLGKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPE
VCIFFGHKLMRGNRTVKVSSNSLDAFDSPNVPPLARIGIDVNVDYRLIFRPCSIERFCVH
LNLDENVGLLRIFPSISHSTFRAFLAPPIRGVVLQSFGSGNIPSNRKDLIEELRAADERG
VIIINCTQCPNGTVAEIYDTGKVLCDVGVIPGYDMTPEAALSKLAYVIGKTEWSLEVKKQ
MMQSNLRGELTSVKAAKIEDYDLVDAVARSLHLSSPQELDQLGATLFPAMINAAVSESDL
KKINNLKAYGADLSGINHDQRTALHLACQLGSVDIVKYLLNNGVSVHVRDRYDRTPLLEA
VSTDNHEIIQLLINCGAHLTGSSRAVGEQLCAAAARGSIVRMKSYQLAGADLSQADPSGR
TALHVAALHGHPEVILYVLPYFENPNEKDMLGLTPWDYAERGGHPAVLEALKSTG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgaacggaggagatgcgccggcacatccaccgcacgaaaccctcgcttcgaaa
cccatcgacatcagtgtccggctaccgtcgtcgctccacgagcgtctcacctccttggac
aagggcatgccaccggcctcgcccaccctgcccagtcccaccatccggcggaacaagagc
gacggcaagctgatggcccaggacatcaaggaggcccgggtgaaggtcatctataccggc
ggcaccatcggcatgatgcggaacgagcggagtgttctggcacccattcccaacgctctg
gtgcggcacatccggaagtatcccaacatccacgacgaggagtatgccctgcaacggttt
ggggcttccgcctcgatggcaccactggtcctgcccctcgtccagggcgtggaccgcagg
atactctaccagatcacggagtacacgccgcttctggacagcagcaacatgaccatgaac
gactgggcccgcatcgccagcgatattcagcaatcgtacgagttcttcgacggattcgtt
gtcctccatggcactgacactctctcctacaccgcctcggccctctcgttcatgctggag
aatctcggcaagacggtgatcatcaccggctcccagatacccatttttgagacgcgaacc
gacggcaaggacaacttcacctccgccctgatcatagccggcaactacatcattccggag
gtgtgcatcttcttcggccacaagctgatgcgcggcaaccggacggtgaaggtgagctcg
aactcgctggacgccttcgactcgccgaatgtgccgcccctggcgaggatcggcatagac
gtcaatgtggactaccgactcatcttccggccgtgcagcatagagcgtttttgcgtccac
ctgaatctcgacgagaacgtgggtctgctgcgcatcttcccgagcatttcacactccacc
ttccgtgccttcctggcgccaccgatccgcggcgtggtgctgcagtccttcggctctggc
aacatcccttcgaaccgcaaggacctcatcgaggagctgagggctgccgatgagcggggc
gtgatcatcatcaactgcacccagtgtcccaatggcactgtggccgagatctacgacacg
ggcaaggtcctgtgcgatgtgggcgtgattcccggctacgacatgaccccggaggcggcg
ctctccaagctggcctacgtcattggcaagacggagtggtccttggaggtcaagaaacag
atgatgcagtcgaacctgcgcggcgaactgacctcggtgaaggcggctaaaatagaggac
tacgatctggtggacgcagtggctcgatccctgcacctgtcctcgccacaggaactggac
cagctgggcgccaccctcttcccggccatgataaacgccgccgtgtcggagagcgatctt
aagaagatcaacaacctgaaagcctacggagctgacctctccggcattaatcacgaccag
agaacggccctccacctggcctgtcagctgggcagtgtcgacatcgtcaagtacctgctg
aacaatggagtctctgttcatgtccgtgatcggtacgaccgcacacccctgctggaggca
gtgtccaccgacaaccacgagatcatccagctgctgatcaactgtggcgcccatctcacc
ggatcctcgcgggcggtgggtgagcagctgtgtgccgcggcggccaggggctccattgtt
cggatgaagtcctatcaactggccggcgccgatctctcccaggccgatccgtcgggcagg
acggctctgcatgtggctgccttgcacggccacccggaagtcatcctctacgtcctcccg
tatttcgagaatcccaacgagaaggacatgctcggcctgacgccgtgggattatgcagaa
cgaggtggacatcctgcggttttggaagccctaaaatccacaggatga

DBGET integrated database retrieval system