KEGG   Drosophila ananassae: Dana_GF20842Help
Entry
Dana_GF20842      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K08738  cytochrome c
Organism
dan  Drosophila ananassae
Pathway
dan04214  Apoptosis - fly
dan04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:dan00001]
 Cellular Processes
  Cell growth and death
   04214 Apoptosis - fly
    Dana_GF20842
   04215 Apoptosis - multiple species
    Dana_GF20842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6503534
NCBI-ProteinID: XP_001965293
FlyBase: FBgn0097848
UniProt: B3MU98
Position
Unknown
AA seq 104 aa AA seqDB search
MGADAENGKKIFVQKCAQCHTAEPGGKHKVGPNLGGIVGRKCGTASGYKYTDANIKKGVT
WTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcggatgccgaaaatggaaaaaagatcttcgttcagaagtgtgctcagtgccac
accgctgaaccgggtggcaagcacaaggtgggccccaatttgggcggtatcgtgggtcgc
aaatgtggcactgcctccggttacaaatacaccgatgccaatatcaagaagggtgttacc
tggaccgagggcaacctggacgagtatctcaaggatccgaagaaatacattcccggcacc
aaaatggtgtttgccggactgaaaaaagccgaggatcgggccgatttgatcgcctacctc
aagaaaaataagtag

DBGET integrated database retrieval system