KEGG   Drosophila ananassae: Dana_GF21023Help
Entry
Dana_GF21023      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
dan  Drosophila ananassae
Pathway
dan04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:dan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Dana_GF21023
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dan01001]
    Dana_GF21023
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dan03036]
    Dana_GF21023
Enzymes [BR:dan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Dana_GF21023
Protein kinases [BR:dan01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   Dana_GF21023
Chromosome and associated proteins [BR:dan03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Dana_GF21023
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding Kinase-like PH C1_1 Seadorna_VP7 C1_2 Pkinase_C
Motif
Other DBs
NCBI-GeneID: 6503712
NCBI-ProteinID: XP_001963879
FlyBase: FBgn0098028
UniProt: B3MRC3
Position
Unknown
AA seq 1369 aa AA seqDB search
MDVERRRRANTLESEMRDPTSICNVDCLLDTVSALVHDCDHDSLRRLKNIEQYATKYKPL
AQRINQLRMNVEDFDFIKLIGAGAFGEVQLVRHKSSSQVYAMKRLSKFEMMKRPDSAFFW
EERHIMAHANSEWIVQLHFAFQDHKYLYMVMDFMPGGDIVSLMGDYEIPEKWAIFYTMEV
VLALDTIHNMGFVHRDVKPDNMLLDRYGHLKLADFGTCMRMGANGQVVSSNAVGTPDYIS
PEVLQSQGVDNEYGRECDWWSVGIFLYEMLFGETPFYADSLVGTYGKIMDHKNSLSFPPE
VEISEQAKSLIRAFLTDRTQRLGRYGIEDIKAHPFFRNDTWSFDNIRESVPPVVPELSSD
DDTRNFEDIERDEKPEEVFPVPKGFDGNHLPFIGFTYTGDYQLLSSDTVDAESKESNTAN
SGTAGSNNHGHSHNHRHRPSNSNELKRLEALLERERGRAEALEQQDAGLRQQIDLSTKRE
AELQRIAAEYEKDLALRQHNYKVAMQKVEQEIELRKKTEALLVETQRNLENEQKTRARDL
NINEKVVSLEKQLTEMEQSYKGETENTQKLKKQNAELGFTLKSQEEKVRDMVDMIETLQK
HKEELGQENAELQAQVVQEKNLRSHMKELHKEAENKMQTLSNDIERTLSREQKAQEDNRA
LLEKISDLEKAQASLDFELKAAQGRYQQEVKAHQETEKSRLVSREEANLQVVKAVQSKLN
EEKSARIKADQHSQEKERQLSMLSVDYRQIQLRLQKLEGECRQESEKVAALQSQLDQEHS
KRNALLSELSLHSSEVAHLRSRENQLQKELAAQREAKRRFEEDLGQLKSTHHEALANNRE
LQAQLEAEQCFSRLYKTQANENREESAERLAKIEDLEEERVSLKHQVQVAVARADSEALA
RSIAEETVADLEKEKTIKELELKDFVMKHRNEINSKEASLVTLKEAEAELHKKLSQKSAE
CEDLVQQHKKQQEELSQLCGSKDEEIAKLMEKCKNEVLLKQVAVNKLAEVMNRRDSDQPK
QKNKARSTAELRKKEKEMRRLQQELSQERDKFNQLLLKHQDLQQVYAEEQQLKQKMIMEI
DCKATEIENLQSKLNETASLSSADNDPEDSQDSVFEGWLSVPNKQNRRRGHGWKRQYVIV
SSRKIIFYNSDIDKHNTTDAVLILDLSKVYHVRSVTQGDVIRADAKEIPRIFQLLYAGEG
ASHRPDEQSQLDVSVLHGNSNEERPGTIVHKGHEFVHITYHMPTACEVCPKPLWHMFKPP
AAYECKRCRNKIHKEHVDKTDPLAPCKLNHDPRSARDMLLLAATPEEQSLWVARLLKRIQ
KSGYKANSSNNNSTDGSKISPSQSTRSSYKPYAVNVQRSATLPANSSLK
NT seq 4110 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggaaaggcggcgtcgggcgaatacgctggagagcgagatgcgcgatccgacc
agcatctgcaacgtggactgcttgctggacacggtgtcggctttggtccacgactgcgac
catgactccctgcggcgtctcaagaacatcgagcagtatgccaccaaatataaacccctc
gcccagcggatcaaccagctgcgcatgaatgtggaggacttcgacttcatcaagctgatc
ggcgccggggccttcggagaggtgcagctggtgcgccacaagtcctccagccaggtgtac
gccatgaagcggctctccaagttcgagatgatgaagcgcccggactccgccttcttctgg
gaggagcgccacatcatggcacacgccaactcggagtggatcgtccagctgcactttgcc
ttccaggaccacaaatacctgtatatggtgatggactttatgcccggcggcgacatagtg
tccctgatgggcgactacgagataccagagaagtgggcaattttctacacgatggaagtg
gtcctggccctggacaccatccacaacatgggcttcgtgcaccgcgacgtcaagccggac
aacatgctcctggacagatacggccacctgaagctggccgacttcggcacctgcatgcgg
atgggcgccaacggacaggtggtgtccagcaatgccgtgggcacgccggactacatcagc
cccgaggtgctgcagtcccagggcgtggacaacgagtacggacgcgagtgcgactggtgg
tcggtgggcatctttctgtatgagatgctcttcggcgagaccccgttctatgcggactct
ctggtgggcacctacggaaagatcatggaccacaagaactcgctgagcttcccgcccgag
gtggagataagcgagcaggccaagtccctgatccgcgcattcctgacagataggacgcag
cggttaggtcgctacggcattgaggacatcaaggcgcacccgttcttccgcaacgacacc
tggtccttcgacaacatccgcgaaagtgtgccgcccgtggtcccggaactgtcgtccgat
gatgatacccgaaactttgaggatattgagcgggacgagaagccggaggaggtcttcccg
gtgccaaagggcttcgacggcaaccatctgcccttcatcgggttcacctacaccggcgac
taccagctgctctccagcgatacggtagatgcggaatcgaaggaatcgaatactgcgaac
agcgggacggcggggagtaacaaccacgggcatagccacaaccatcgccaccgcccgtcg
aactccaacgagctgaagcgcttggaggctttgctggagcgggaacggggccgcgcggaa
gctctggagcagcaggacgccggactgcggcagcagatcgaccttagcaccaagcgagag
gcggagctgcaacggattgccgccgagtacgagaaggacttggccctgcgccagcacaac
tacaaggtggccatgcaaaaggtcgagcaggagattgagctgcgcaagaagacagaggcg
ctgctggtggagacgcaacggaacctggagaacgagcagaagacgagggcacgcgacctg
aacatcaatgagaaggtcgtctccctggaaaagcagctgacggagatggaacagagctat
aagggcgagacggagaacacgcaaaagctcaagaaacagaacgccgagctgggcttcacg
ctcaagtcgcaggaggagaaggtgcgcgacatggtcgacatgatcgaaacgcttcagaag
cacaaggaggaactgggccaggaaaatgccgagctgcaggctcaggtggtgcaggagaag
aacctgcggtcgcacatgaaggaactgcacaaggaggccgaaaacaagatgcagacgctg
tccaatgacattgagcgcacgctgagccgggaacagaaggcccaggaggacaatcgggcg
ctgctggagaagatcagcgacttggagaaggcccaagccagcctagacttcgaactgaag
gcagcccagggacgctaccagcaggaggtgaaggcccaccaagagacagagaagtcgcgc
ctcgtctcccgcgaggaagccaatctccaggtggtcaaggccgtccagtccaagctcaac
gaggagaagtcggcccgcatcaaggccgaccagcactcgcaggagaaggaacgacagctg
agtatgctgtcggtggactaccgccagatccagctgcgtctccagaagctcgagggcgag
tgccgccaggaatcagaaaaggtggccgccctccagtcccagctggaccaggagcacagc
aaacggaacgccctgctctcagagctcagtctgcatagctcggaggtggctcacttgcgt
tcccgcgagaaccagctgcaaaaggagctggctgctcagcgggaggccaagcggcggttt
gaggaggatcttggccagctaaagagcacccaccacgaggcgctggccaacaacagggag
ctgcaggcccaactggaggcagagcagtgcttctcgcgcctctacaagacccaggccaac
gaaaaccgcgaggagagcgccgagcggctggcgaagatcgaggacctcgaggaggagcgc
gtatcgctcaagcaccaagtccaagtggccgttgctcgcgccgattctgaagccctggcc
cggtcgattgccgaggagacggtggctgacctggagaaggagaagacgatcaaggagctg
gagctgaaggactttgtgatgaagcaccgcaacgagatcaactccaaggaggcgtccctg
gtcacgctcaaggaggcagaggcggagctgcacaagaagctcagccagaagagcgccgag
tgcgaggacctggtccagcagcacaagaagcagcaggaggagctgtcccagctgtgcggc
agcaaggacgaggagatcgccaagctgatggagaagtgcaagaacgaggtgctgctcaag
caggtggcagtcaacaagctggcggaggtgatgaaccgccgggattccgaccagcccaaa
caaaagaacaaggcccgttccaccgccgagctacgcaagaaggaaaaggagatgcgccgg
ctacagcaggagctctcgcaggagcgcgataagttcaaccagctgctgctgaagcaccag
gacctgcagcaggtgtacgccgaggagcagcagctgaagcagaagatgatcatggagatc
gactgcaaggccacagaaatcgagaacctgcagagcaagctgaacgagacggcgtcgctc
tcctccgcagacaacgatcccgaggatagccaggactcggtcttcgagggatggctgagc
gtgcccaacaagcagaaccggaggcgcggccacggctggaagcgccagtacgtcatcgtc
tcctcgcggaagataatattctacaactcggacatcgacaagcacaacaccacggacgcc
gtgctcatcctggacctcagcaaagtgtaccacgtacgcagtgtcacccagggcgatgtc
atacgcgccgacgccaaagagatcccgcgcatcttccagctgctctacgccggcgagggc
gcctcccatcgccccgatgagcaaagccagctggatgtgagcgtgctgcacggcaacagt
aatgaagaacgccccggcaccatagtccacaagggtcacgagttcgtccatatcacctac
cacatgcccacggcctgcgaggtgtgcccgaagccgttgtggcacatgttcaagccgccg
gcggcttacgaatgcaagagatgccgcaacaagatccacaaggagcatgtggacaagaca
gacccgctcgcgccctgcaagctgaaccacgatccgcgcagtgcccgggatatgctgctg
ctggccgcaacgcccgaggagcagtccctgtgggtggcccgcctgctgaagcgtatccaa
aagagtggatacaaggccaactcgtcgaacaacaacagcactgacggcagcaagatttcg
cccagccaatcgacgcgatcgtcctacaagccgtatgctgttaatgtgcaacgctccgcc
acgctgccagccaactcgtcgctaaaatga

DBGET integrated database retrieval system