KEGG   Drosophila ananassae: Dana_GF21148Help
Entry
Dana_GF21148      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
Organism
dan  Drosophila ananassae
SSDB OrthologParalogGFIT
Motif
Pfam: SSF YrhK
Motif
Other DBs
NCBI-GeneID: 6503834
NCBI-ProteinID: XP_001963686
FlyBase: FBgn0098151
UniProt: B3MQT0
Position
Unknown
AA seq 606 aa AA seqDB search
MHVEELRASLQSFGWPDYLVFCLMLAICAVIGIHFCLQLRRESRSQKAQGKDAEELASSA
ASYLVGGRQMKVFPITMSLISSFISGITLLGTPTEVYLYGAQYLYIMGSLVLMGFCMYYF
FLPVFHELNLISTYKYLEQRYNRSLRLFGSVMFIVASLLWLPIVIYVPAIAFNQATGVNI
HVVTPIVCLVCIFYTCIGGLKAVVWTDVVQTLIMFGAMALVLIKGTLDIGGPGVVWQRAR
ETARLERPNFSTDLTERYTFFSLVLGGVAHWLKSNAISQNMIQRYLSLPTLRHARIAIWT
FIAGVLAFILICGYTGLLIYATYAQCDPLETKLAQRNDQLLPLLVMETLGKYPGLPGVFV
AGVFSAALSSLSTGLNSLSAVVLEDFVKTFRKAPLTERQTAFVMRSVVVVFGVLFVALVF
AVEKLGAVLQLTITLSSVANGPLLGIFTAGVMLPWVSSRGALLGGFSSLLVMAWMCVSAQ
RDLVTGDLVYRRKPYSTMGCNYTFAGEPADFSPLPLDGSFGFSTSSTNGPFQLYRISYLY
FTLFGALVTIVVALVVSLLLRESDLDTVDTRLLTPFVRRWVERRRHRRSQTPLSTHKSKD
LKETLT
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtggaggagctgagagccagcctgcagagcttcggctggccggactacctggtc
ttctgcctgatgctggcaatttgcgccgtgatcggaatccacttctgtctccagctgcgc
cgcgagtcccggagccagaaggctcagggaaaggacgcggaggagctggccagcagtgcc
gccagctatctggtggggggcaggcagatgaaggtgtttcccatcaccatgtccctcata
tccagcttcatctcgggaatcactctgctggggacacccacggaggtgtacctctacggc
gcccagtacttgtacatcatggggtcgctggtcctgatgggcttctgcatgtactacttc
ttcctgccggtcttccacgagctgaacctgatatccacctacaagtacctcgagcagcgc
tataaccgcagtttgaggcttttcggctcggttatgtttattgtggcttcgctcctgtgg
cttccgattgtgatttatgtgccggccatagccttcaaccaggccacgggcgtgaacatc
cacgtagtgacccccatcgtgtgcctggtctgcatcttctacacctgcatcggcggcctg
aaggcggtcgtttggacggacgtcgtccagacgctgatcatgttcggggcgatggccctg
gtcctgatcaagggcaccctggacatcggagggcccggagtggtgtggcagagggcccgc
gaaacggcccgcctggagaggcccaacttcagcacggacctgaccgagaggtacaccttc
ttctcgctcgtcctgggcggagtggcccactggctgaagtcgaacgccatcagccagaac
atgattcagcggtacctgtcgctccccaccctcaggcacgcccggattgcgatctggacg
ttcatcgccggggtcctcgccttcatcctgatctgcggctacacgggcctcctgatatac
gccacctacgcccagtgcgaccccttggaaacgaagctggcccagcggaacgaccaactg
ctgcccctcctggtgatggaaaccctcggcaagtacccgggcctgccaggagtgttcgtg
gccggcgtcttcagcgctgccctgtcatccctgtccaccggcctaaactccctatcagcc
gtcgtcctggaggactttgtgaagacgttccgcaaggcgccgctcaccgagagacagact
gccttcgtgatgcgcagcgtggtggtggtgttcggcgttctgttcgtggccctggtcttc
gcggtggagaagctgggcgccgtgctgcagctgacgatcaccctctcctccgtggccaac
ggtccgctcctgggcatcttcaccgccggcgtcatgctgccctgggtgagctccagggga
gcgcttctcggcggcttcagctccctgctggtgatggcctggatgtgtgtgagcgcccag
cgggacctcgtcaccggggacttggtctaccggcggaagccctactccaccatgggctgc
aactacaccttcgctggggagcccgcggacttttctcccctcccactcgacgggtccttc
ggcttctccaccagctccacgaacgggcccttccagctttaccgcatctcgtacctctac
ttcactctgttcggcgccctggtcaccatcgtggttgccctggtggtgagcctgctcctg
cgggagtccgacctggacacggtggacacccgtctgctcacgcccttcgtgcgccgttgg
gtggagcgccgccgccaccggagatcacagacgcccctgtccacccacaagagcaaggac
ctcaaggagacgctcacgtga

DBGET integrated database retrieval system