KEGG   Drosophila ananassae: Dana_GF21939Help
Entry
Dana_GF21939      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dan  Drosophila ananassae
Pathway
dan00220  Arginine biosynthesis
dan00330  Arginine and proline metabolism
dan01100  Metabolic pathways
dan01230  Biosynthesis of amino acids
Module
dan_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Dana_GF21939
   00330 Arginine and proline metabolism
    Dana_GF21939
Enzymes [BR:dan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Dana_GF21939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase PAS_8
Motif
Other DBs
NCBI-GeneID: 6504609
NCBI-ProteinID: XP_001966533
FlyBase: FBgn0098939
UniProt: B3MYX7
Position
Unknown
AA seq 366 aa AA seqDB search
MWLLSSSVASSVAYKSYKNMWWSRKLASRCLRLHRAKSTASEPEQTLGIIGVPFAKGQGK
QGVELAPDLLRQSSLRQVLQSSHDGLVIRDYGNLQYSVDESLLQQQRVHYHHIRNYADFM
ACNRALIEQVKEMLKENSQFLAIGGDHAIGFGSVAGHLQHTPDLSLVWIDAHADINLHST
SQSGNIHGMPVSFLLEQLRTTWQHAGLQDIAPNCLPKDQLVYIGLRDIDPYEAFILNKVG
IRYYAMDTIDRVGVPKIIEMTLDALNPQNKIHVSFDIDALDSNVAPSTGTAVRGGLTLRE
GISIVEALRDTKRVQGVDLVEINPKLGSERDVRTTVESGLEILKSMFGYRRSGNWSNIDT
GILGSD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgctcagtagctcagtagcttccagcgttgcgtacaaatcgtacaaaaatatg
tggtggagccgtaagttagcctcgagatgtctccgcctccacagggccaagagcaccgcc
tcagagccggagcagacgctgggcatcatcggagtgcccttcgccaagggtcagggcaag
cagggcgtggaactggcaccggatctcctccggcagagcagtctgcggcaggtcctacaa
agtagtcatgatggcttggttataagggactatggtaacctgcagtactccgtggacgag
tccttgctgcagcaacagcgcgtccactaccaccacatccggaactatgccgacttcatg
gcctgcaaccgggcgctgatcgagcaggtgaaggagatgctcaaggagaactcccagttc
ctggccattggcggtgatcatgccatcggttttggttcggtggctggacatttacagcat
acgccggatttatcgctggtgtggatcgatgcacatgcggacatcaatctgcatagcacc
tcgcagtcgggcaacatccatggcatgcccgtgtcctttctattggagcagctgcgcacc
acctggcagcatgccggcctccaggacatagctcccaactgtttgcccaaggatcagttg
gtttacatcggcctgagggacattgacccctacgaggcgttcatactgaacaaagttgga
atacgctactatgccatggatacaatcgatcgcgtgggagtgcccaagatcattgagatg
actctggatgcgctgaatccccagaacaagatccacgttagcttcgacatcgacgccctg
gacagcaatgtggcgcctagcaccggtaccgccgtccggggcggtctcaccctccgcgag
ggcatcagcatcgtggaggcactgcgggacaccaagcgggtccagggcgtggatctcgtg
gagatcaatccaaagctgggcagcgagcgagatgttcgcaccaccgtcgagtccggcttg
gagatccttaagagcatgtttggctatcggagatccggaaactggagcaacatcgacact
ggcatcctggggagcgattaa

DBGET integrated database retrieval system