KEGG   Drosophila ananassae: Dana_GF21951Help
Entry
Dana_GF21951      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
dan  Drosophila ananassae
Pathway
dan00062  Fatty acid elongation
dan00071  Fatty acid degradation
dan00280  Valine, leucine and isoleucine degradation
dan00310  Lysine degradation
dan00380  Tryptophan metabolism
dan00410  beta-Alanine metabolism
dan00640  Propanoate metabolism
dan00650  Butanoate metabolism
dan01040  Biosynthesis of unsaturated fatty acids
dan01100  Metabolic pathways
dan01200  Carbon metabolism
dan01212  Fatty acid metabolism
Module
dan_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
dan_M00085  Fatty acid biosynthesis, elongation, mitochondria
dan_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dana_GF21951
   00650 Butanoate metabolism
    Dana_GF21951
  Lipid metabolism
   00062 Fatty acid elongation
    Dana_GF21951
   00071 Fatty acid degradation
    Dana_GF21951
   01040 Biosynthesis of unsaturated fatty acids
    Dana_GF21951
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dana_GF21951
   00310 Lysine degradation
    Dana_GF21951
   00380 Tryptophan metabolism
    Dana_GF21951
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dana_GF21951
Enzymes [BR:dan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     Dana_GF21951
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dana_GF21951
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 DUF4378
Motif
Other DBs
NCBI-GeneID: 6504621
NCBI-ProteinID: XP_001964891
FlyBase: FBgn0098950
UniProt: B3MUW0
Position
Unknown
AA seq 789 aa AA seqDB search
MSASRFLSAVGQISRQQLLQNKCTRALPISSQLLQQRRLMSTNPAPAVAPAAGANKHLHT
KVVNGVLVIRIDSPNAKVNSLGTEVSNEFESVIKDLETNPSVNSAVLISGKPGCFVAGAD
IGMLEKCETAAEATLISHGAQLMFDRMERSRKPIVAAINGVCLGGGLELALACHYRIATK
DSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDLELTGKQVRADRAKRLGIVDLLVD
PLGPGLQPAEQNTIEYLEKTAVQVASDLASGKIRVNREKTGLVNKIQSFVMETDFVKNKI
FDTARKQVLKASNGLYPAPLKILDVVRAGVDKGAEAGYEAERKGFGELSATPESKGLIAL
FRGQTECKKNRFGKPERQVKTVGVLGAGLMGAGIVQVSVDKGYKVVMKDATEAGLGRGIG
QVQKGLETAVKRKRISALERDQTLASLRPTLDYNDFKNADIIIEAVFEDIKIKHKVIKEL
EAVVPEHCIIATNTSAIPITKIAAGSSRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTV
AQAVAVGLKQGKVVITVGDGPGFYTTRILATMLSEAIRLLQEGVDPKDLDQYTKKFGFPV
GAATLADEVGIDVGSHIAVDLAKSFGERFSGGNLEVMNDLVLAGFLGRKSGKGIFLYDGQ
SKGSRPINNDALEIVKQKYALVSKGANTPEDLTLRLVSRFVNEAVLCLEEKILDSPLEGD
VGAVFGLGFPPFSGGPFRWVDQYGAGKLVSKMQSYAELYGAPFKPAQTLLDMAKDPAKKF
YPKTGSSKL
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatcgagatttctgagtgcagttggacaaatttcccggcagcagttgctgcag
aataagtgcacgagagccctgcccatttcgagccagctgctccagcagcgccgccttatg
tccacgaaccccgctcccgccgtggccccggctgccggcgccaacaaacacctgcacacc
aaggtggtcaacggcgtcctggtcatccggatcgattcccccaacgccaaggtcaactcc
ctgggcaccgaggtcagcaacgagttcgagagcgtcatcaaggatctggaaacgaatccc
tcggtcaactcagccgtcctcatctccggcaagccgggatgctttgtggctggagcggat
atcgggatgctggagaaatgcgagaccgcggcggaggccaccctgatctctcacggcgct
cagctgatgttcgaccgcatggaacgcagccggaagcccattgtggccgccattaacggc
gtctgcctgggcggtggcctggagctggcactggcctgccactaccgcatcgccaccaag
gacagcaagaccaagctgggcctgccggaggtcatgctgggtctcctgcccggcggtggc
ggaactgtgcgtctgcccaaactcacctccgtgcccacggctctggatctggaactgact
ggcaagcaggtccgcgccgaccgcgccaagcgcctgggcattgtcgatctgctggtggat
cccctcggccccggactccagcctgcggagcagaacaccatcgagtatctggagaagact
gccgtgcaggtggccagtgacctcgccagcggaaagatccgcgttaatcgcgaaaagacc
ggtctggtgaacaagatccagtcctttgtgatggaaactgattttgtgaagaacaagatc
ttcgacacggccaggaagcaggtcctgaaagcctccaatggtctctatcccgctcccctg
aagatcctcgacgtggtgcgagctggtgtggacaagggcgccgaggcgggctatgaggcc
gagcgcaagggcttcggcgagctgtctgccacgcccgagtcaaagggtctgattgccctc
ttccgcggccaaaccgagtgcaagaagaaccgcttcggcaagcccgaacggcaagtcaag
actgtcggtgttctgggtgctggcctgatgggggccggtatcgtccaggtctccgtggac
aagggctacaaggtggtgatgaaggacgccaccgaagctggcctgggtcgcggtatcggt
caagtgcagaagggtctcgagaccgctgtgaaacgcaagcgaatctctgccctggaacgc
gaccagactttggccagcctccgacccaccctggactacaacgacttcaagaacgcggac
attattattgaggccgtgttcgaagacattaagattaagcacaaggtgatcaaggagctg
gaagctgtggtgccggagcactgcatcattgcgaccaacaccagcgccattcccatcacg
aagatcgccgcaggcagctcgcgccccgagaaggttgtgggcatgcactacttctcgccc
gtcgataagatgcagctgctggagattatcacccacccaggaacctccaaggacactgtt
gcccaggctgtggccgtgggcctcaagcagggcaaggtcgttatcaccgtgggcgacgga
cctggtttctacaccacccgcattctcgccactatgctgtcggaggccataagattgctc
caggagggcgtggatcccaaggatctcgaccagtataccaaaaagttcggtttcccggtg
ggagccgctaccctggccgatgaggtcggcatcgatgtgggctcccacatcgccgtggat
ctggccaaatccttcggcgaacgcttcagcggcggcaacctggaggtgatgaacgacctg
gtcctcgccggtttcctgggtcgcaaatctggaaagggcatcttcctctacgatggccag
tcgaagggctctcgtccgatcaacaacgacgccttggaaattgtcaagcagaagtacgcc
ctggtctcgaagggcgccaacacacccgaggacctgaccctgcgcctggtgtcccgcttc
gtcaacgaagctgtgctctgcctggaggagaagatcctggacagtccgctggagggcgac
gtgggcgctgtctttggcctgggcttcccgccattctccggcggccccttccgttgggtt
gaccagtacggagctggaaagctggtcagcaagatgcagtcgtacgccgagctctatggc
gctccgttcaagcccgcccagacactcctcgacatggccaaggacccggcgaagaagttc
taccccaagactggctcctcgaaattgtag

DBGET integrated database retrieval system