KEGG   Drosophila ananassae: Dana_GF22035Help
Entry
Dana_GF22035      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
dan  Drosophila ananassae
Pathway
dan00020  Citrate cycle (TCA cycle)
dan00640  Propanoate metabolism
dan01100  Metabolic pathways
dan01200  Carbon metabolism
Module
dan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dana_GF22035
   00640 Propanoate metabolism
    Dana_GF22035
Enzymes [BR:dan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     Dana_GF22035
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Dana_GF22035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 6504704
NCBI-ProteinID: XP_001966363
FlyBase: FBgn0099034
UniProt: B3MYF7
Position
Unknown
AA seq 356 aa AA seqDB search
MSLGLKRSLLWVVAPWRVCVPAASWHPLHLQQCRHAAKSSYDKTVCNLKVNKDTKVMVQG
FTGKQATFHSKESIKYGTKIVGGVSPNKGGTQHLDKPVFKDVAEAVKELKPDATVIFIPP
PSAAEGICAAIENEIGLIVAITEGIPQVDMVRIMQMLRCQEKSRLLGPNCPGLISPDQCK
IGIMPGHIHKRGCVGIVSRSGTLTYEAVHQTTGVGLGQALCIGCGGDPFNGTSFIDALRI
FLPDKEVKGIILIGEIGGTAEEEAADYLMANNTGCEAKPVVAFIAGQTAPPGRRMGHAGA
IISGGKGAASDKVKALEKAGVKVATNPCHMGITLYNEMVRLKLVPKLEKKDKKDKK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgggattgaagaggtccttgttgtgggtcgttgccccctggcgtgtctgtgtc
ccggccgcatcctggcatccgctccatcttcagcagtgtcgccacgccgcaaagtccagc
tacgacaagacggtctgcaatctgaaagtgaacaaggacaccaaggtcatggtccagggc
ttcaccggcaaacaggccacattccactccaaggagtcgatcaagtatggcaccaagatc
gtcggcggcgtctcaccaaacaagggcggcacccagcacctggacaagccggtcttcaag
gacgtggcggaggccgttaaggaactgaaaccggatgccaccgtcatcttcataccgcca
ccgtcggccgccgagggtatttgtgcggcgatcgagaatgagattggactcattgtggcc
attacggagggcataccccaggtggacatggtccggatcatgcagatgctgcgctgccag
gagaagtctcgccttttggggcccaactgtccgggtctgatatcgccggatcagtgcaag
atcggcatcatgcccggccacatccataagcgtggctgtgtgggaattgtctcccgatcc
ggaacactcacctacgaggccgtccatcagaccaccggggtgggtctcggccaggcactg
tgcatcggatgtggcggtgatcccttcaacgggaccagcttcatcgacgccctgcgcatc
ttcctgccggacaaggaggtcaagggcatcattctgatcggtgagattggcggcaccgcc
gaggaggaggccgccgactatctgatggccaataatacgggctgtgaggctaagcccgtg
gtggcattcatagccggacagacggcgccacctggtcgccggatgggacatgccggtgcc
atcatatcggggggcaagggggcggccagtgacaaggtcaaggcgctggagaaggccggc
gtcaaggtggccaccaatccgtgccacatgggcatcacactctacaacgagatggtgcgc
ctcaaactggtccccaaactggagaaaaaggacaaaaaggacaagaaatag

DBGET integrated database retrieval system