KEGG   Drosophila ananassae: Dana_GF22663Help
Entry
Dana_GF22663      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K02890  large subunit ribosomal protein L22
Organism
dan  Drosophila ananassae
Pathway
dan03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dan00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Dana_GF22663
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dan03011]
    Dana_GF22663
Ribosome [BR:dan03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Dana_GF22663
  Bacteria
    Dana_GF22663
  Archaea
    Dana_GF22663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 6505318
NCBI-ProteinID: XP_001965749
FlyBase: FBgn0099657
UniProt: B3MWB9
Position
Unknown
AA seq 232 aa AA seqDB search
MHKVIRQMSQLRMQSQLPGAALLKPANTFSPNLSQSPPALPKSIHTAAGAAGGTLCTKWN
KHNYGPRKWLEYNKTVHPPQEPEEEPRKAYVCHMRTNIKYSPDKMWYIAAFVRGMSVDEA
LKQLNFVLKKGATDVRETILEAQEMAVQRHNVEYKSNLWIAESFVGKGRVFKGMRRHARG
RYGKVEYKHCHYFVRLEEGNPPEHYYQEPQTPEQQYEHWLEQMRSRKIINSL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaggtgatccggcagatgtcccagctgcgcatgcagtcccagcttccgggtgca
gcgctccttaagccggcaaacacgttcagccccaatctgagtcaatcgccacctgcgctc
ccaaaaagtatccacacggcggcaggagctgcgggcggaactctctgtaccaagtggaac
aagcataactacggtccgaggaagtggctggagtacaacaagacggtccatccgccgcag
gaaccagaagaggagccccgcaaagcctacgtttgtcacatgcgcaccaatatcaaatac
agtccggacaagatgtggtacatcgctgccttcgttcggggcatgtccgtcgatgaggcg
ctgaagcaactcaactttgtcctcaaaaagggggccaccgatgtgcgggagaccattctg
gaggcccaggaaatggccgtccaaaggcacaatgtggagtacaaaagcaatctgtggata
gctgaatcctttgttggcaagggacgtgtcttcaagggaatgcgtcgacatgcccgcggt
cgttatggcaaggtggagtacaagcactgtcactactttgtccgcctggaggagggaaac
ccgccggagcactactaccaggagccacagacgcccgagcagcagtacgagcactggctg
gagcagatgcgcagccggaagatcatcaactcgctgtag

DBGET integrated database retrieval system