KEGG   Drosophila ananassae: Dana_GF23359Help
Entry
Dana_GF23359      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
dan  Drosophila ananassae
Pathway
dan00230  Purine metabolism
dan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dan00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Dana_GF23359
Enzymes [BR:dan01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     Dana_GF23359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Motif
Other DBs
NCBI-GeneID: 6506001
NCBI-ProteinID: XP_001964760
FlyBase: FBgn0100353
UniProt: B3MTG6
Position
Unknown
AA seq 676 aa AA seqDB search
MACPFFRRADSLTRQPSVIADPGTHWALEDEELSDDALTLTHLQMAIQLLTAPSNEDLNT
AVTSLVAKYRQNWPNIHKLKLDPQTFKSCANYDYLADIQELLLKMDEASASEILVLLGEE
LITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVLKLQEDDVTDTGFVCAGEGELIFTSE
RPVIAWLLLGSLKALTRMLYKVDVNIKIEPVEGDARRYRYLFSLVKDSSHTMLMGRPAFV
SKTIPETVQRSNSSNASDLQMNSSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYLADF
GCQASTYFDFKRPKGLTMKFRDIVRRTYTPFLIGLNSPPGVTDFPAIGLEIKGQMVHCPE
SNSLLFMGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKLKSS
IEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICS
RATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALK
MIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALK
INVSPTTKEWLTKHEGFDFDLQPREPGCLPKEFPNPEGTETCYFLEGYRNPALDSSLPLV
EHINAAMKTISEGGDA
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtcctttcttcaggcgagcggactcgctgacacgccagccctcggtcatcgcc
gaccctggcacccactgggccctcgaggacgaggagctctccgacgatgccctgaccctc
actcacctccagatggccatccagctcctgacggctccctcgaacgaggatctcaatacg
gcagtcacttccctggtggccaagtatcgtcagaattggcccaacatacataaattaaaa
ctggatccccaaaccttcaagagctgcgccaattatgattacctggccgacatccaggag
ttgcttctgaaaatggatgaggcgagtgccagcgagatcctggtgcttttgggtgaggag
ttgatcacctgttgctgcactggaatcatagaacgggccttccgctgtctgggaaccgat
cttcaggagtttttgggctcactcgatggagtctacgatgtgctcaagttgcaggaggac
gatgttaccgacactggcttcgtgtgtgccggcgagggtgagctgatcttcacctcggag
agacctgtaattgcctggctgcttttgggctccttgaaagccctcacccggatgctctac
aaggtggatgtgaacatcaagatcgaacccgtagagggcgatgctcgtcgctatcgatac
ctcttctcactcgtcaaggacagctctcacaccatgttgatggggcgtcctgctttcgtt
agcaagaccattccagaaaccgtacagagaagcaattcgagcaacgcctccgacttgcaa
atgaactcgtcgagcttctgtaagatgttcccctggcatttcatcatgaacgagcagctg
gagttggtgcaactgggccggggattcagcaagctgtacaagccctatttggcggacttt
ggctgccaggcgagcacttactttgattttaagaggcccaagggattgaccatgaagttc
cgggacattgtgcgccgcacttacacccccttcctgattggcttgaacagtccgccgggc
gttaccgatttcccggccatcggcttggagatcaagggtcagatggtccattgtccggaa
tcgaattccttgctgtttatgggctcacccttcctggatgggctggacgggctcacctgc
aatgggcttttcatttcggacataccactgcacgatgccaccagggaggtgatcctggtc
ggggagcaggctcgtgcccaggacggtcttcgtcgccggatggacaaacttaagagcagc
attgaggaagccaattcggcagtaacgaaggagcgaaagaagaacgtcagcctgctgcac
ttgatcttcccggcggagatcgccgaaaagctatggctgggctcatccatcgatgccaag
acctacccggatgtgacaatcctcttcagcgacattgtcggattcacgagcatctgttcg
cgggccacgcccttcatggtgatcagcatgctggagggcctgtacaaggacttcgatgag
ttctgcgacttcttcgacgtctacaaggtggagaccattggcgatgcctactgtgtggcc
agcggactgcaccgcgcctccatctacgatgctcacaaggtggcctggatggccctgaag
atgatcgatgcctgctccaagcacatcactcacgacggcgagcaaatcaaaatgagaatc
ggcctccacacaggcactgtcctggccggagtggtgggcaggaagatgcccaggtactgc
ctcttcgggcacagtgtcaccatagccaacaagttcgagtcgggcagcgaggctcttaaa
atcaatgttagcccaactaccaaagaatggctgaccaagcacgagggcttcgatttcgac
ctgcagccccgcgaaccgggctgtctgcccaaggagttccccaatccggaaggcaccgag
acctgctacttcctggagggctatcgcaacccggccctagacagcagcctgcccctggtg
gagcacatcaatgcagccatgaagaccatatcggagggtggcgatgcctag

DBGET integrated database retrieval system