KEGG   Drosophila ananassae: Dana_GF24546Help
Entry
Dana_GF24546      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein
  KO
K07583  tRNA pseudouridine synthase 10 [EC:5.4.99.25]
Organism
dan  Drosophila ananassae
Brite
KEGG Orthology (KO) [BR:dan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dan03016]
    Dana_GF24546
Enzymes [BR:dan01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     Dana_GF24546
Transfer RNA biogenesis [BR:dan03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    Dana_GF24546
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 6507178
NCBI-ProteinID: XP_001965325
FlyBase: FBgn0101540
UniProt: B3MUD0
Position
Unknown
AA seq 502 aa AA seqDB search
MKNQELVDFLRSCGVCEVCQLRYLKARGSEYKDINETLRNLDIKVNETDENGEVTPSSDD
QPAKKPRLAICSTCLGLFSDEFQKELLEGILNSDFGKYDCQTIVLAISLPMILQLRQLAM
WYALQRKFGPIIDSNNPPDVPIKEAVKLILHPIICEKLGKKYDADGLMISVDLRHKLEEE
EVEKLVKLNKEAFPYKAAHQKRIEISRGLLEKQYQPAKVKADTFEKYFQIPSPIVEEPLE
LKNIELQGPLVCVAGRYRKVNREISHTPWVLNGQRVMEDSIEEIIIRNIGPHFTEKPEKI
IFMSSGREDVDVRCLGKGRPFCLEIPNSIRSSLSQEQAYKMEQAVDESGKVSIVNLQVVA
REELSHIKTGEEQKKKFYRALCALKEPVTVEILENLQISESFDIQQKTPIRVLHRRPLHT
RPRTIYSVKARVQRGNPQALIVDIVTQAGTYIKELVHGEFGRTTPSLSSIIGQAMDIQAL
DVVGIDLEWPPEVDNSLSALKK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcaagaattggtagattttctaagatcctgcggcgtttgcgaagtttgccag
ctgcgctacttgaaggcgagaggctccgagtataaggatataaatgaaacactgcgaaat
ttggatataaaagtgaatgaaactgatgaaaatggagaggttactccttcatcagatgat
cagcctgctaaaaaaccccgccttgccatttgctccacatgtttgggtttattttcggat
gaatttcaaaaggagctcctggaaggaatcctcaactctgattttggtaaatacgattgc
cagacaattgttttagccattagtttgcccatgatcctgcagctgaggcagctggccatg
tggtatgccctgcagaggaaattcgggccgataatagactccaataatcccccggatgtc
ccaatcaaagaggccgtaaagcttattttgcacccaataatatgtgaaaaattgggtaaa
aagtacgacgctgatgggctaatgattagtgtggatctcaggcacaaactggaggaggag
gaggttgagaaactggtgaagcttaacaaggaagcctttccctataaggctgcccaccag
aaacgcatcgaaatctcgcgaggattgctggaaaagcaatatcaacctgcgaaagtcaag
gcggatacttttgagaagtatttccagataccctctccaattgttgaggaacccctggag
ctaaaaaacattgaacttcaaggtcctctagtctgcgtggctggaagatatcgaaaagta
aaccgcgaaatctcgcacacaccttgggtcctcaacggtcagagagtgatggaggacagc
atcgaggagataatcattcggaatattggaccccacttcacggagaagccggagaaaatc
atctttatgtcaagtggtagggaagatgtagatgttcgttgcttgggcaagggaaggccc
ttttgtcttgagattcccaattccatcaggagttcactgtcccaagaacaagcctacaaa
atggagcaggctgtggacgaatcaggaaaagtttctatagtaaatctgcaagtagtagca
agggaggagctgtcgcatataaaaacaggcgaggagcaaaagaaaaaattctaccgtgcc
ctttgtgctctgaaggaacctgtaacagtggagattttggaaaatcttcagatatctgaa
agttttgatatccaacagaaaacacccatacgagtccttcatcgtcgtcctttgcacacg
cgacccaggacaatttatagtgttaaagcccgtgtccaacgtggcaatccacaagcattg
attgttgatattgttactcaagctgggacctatataaaggagctggttcatggggaattc
ggaaggaccacaccctcattatcctcgatcataggccaggccatggatattcaagcttta
gatgtggtcggaattgacttggaatggcctccggaagtagataattcattgtctgcatta
aaaaaataa

DBGET integrated database retrieval system