KEGG   Drosophila ananassae: Dana_GF25278Help
Entry
Dana_GF25278      CDS       T01059                                 

Definition
(RefSeq) uncharacterized protein, isoform A
  KO
K06130  lysophospholipase II [EC:3.1.1.5]
Organism
dan  Drosophila ananassae
Pathway
dan00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:dan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dana_GF25278
Enzymes [BR:dan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dana_GF25278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_2 Abhydrolase_6 Hydrolase_4 FSH1 DLH Abhydrolase_1 Abhydrolase_3 Peptidase_S9 DUF2974 Cutinase LIP Esterase Lipase_3
Motif
Other DBs
NCBI-GeneID: 6507902
NCBI-ProteinID: XP_001956564
FlyBase: FBgn0102270
UniProt: B3M4A0
Position
Unknown
AA seq 232 aa AA seqDB search
MSAPVIVEATVKQTATLIFMHGLGDTGHGWSSALAAIRPPFMKVICPTAPTQPVSLNAGF
RMPSWFDLKTLDIGGPEDEPGIQAARDSVHGMIQKEVSAGIPANRIVLGGFSQGGALALY
SALTYDQPLAGVVALSCWLPLHKQFPDAKVNSDDVPIFQAHGDYDPVVPYKFGQLSASLL
KSFMKNVTFKTYSGLSHSSSDDEMDDVKDIISKWTHWEGQNMARRAQCCGIS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcagcgccggtgattgtcgaggccacggtcaaacagaccgccacgctgattttcatg
catggcttgggagacacgggtcatgggtggagcagcgctcttgccgccatccggccaccc
ttcatgaaggtcatctgccccacggcccccacacagcctgtttcgttaaatgccggcttc
aggatgccatcgtggtttgatctgaagaccctggacattggcggaccggaggacgagcct
ggcattcaggcggcgcgcgacagcgtacacgggatgattcaaaaggaggtcagtgctgga
atacccgcaaaccggatcgttctgggcggtttttcgcagggtggtgccctggcattgtat
tcggcgctgacctacgaccaaccgctggccggtgtggtggctctgtcctgttggttgccg
cttcacaagcagttccccgacgccaaggtcaacagtgatgatgtgcccatcttccaggcg
catggcgactacgatcccgtggtgccctacaaattcggccagctgagtgccagcctgctc
aagtcgttcatgaagaatgtgacgttcaagacctatagtggactatcgcactcgtcgtcc
gacgacgagatggacgacgtcaaggacataatcagtaaatggacacattgggagggccag
aacatggctagaagggcacaatgctgcgggatatcatag

DBGET integrated database retrieval system