KEGG   Desulfobacca acetoxidans: Desac_0001Help
Entry
Desac_0001        CDS       T01454                                 

Definition
(GenBank) Chromosomal replication initiator protein dnaA
  KO
K02313  chromosomal replication initiator protein
Organism
dao  Desulfobacca acetoxidans
Pathway
dao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desac_0001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dao03032]
    Desac_0001
   03036 Chromosome and associated proteins [BR:dao03036]
    Desac_0001
DNA replication proteins [BR:dao03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Desac_0001
Chromosome and associated proteins [BR:dao03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Desac_0001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C DnaA_N IstB_IS21 AAA_16 AAA Mis14
Motif
Other DBs
NCBI-ProteinID: AEB07900
UniProt: F2NGJ3
Position
87..1472
Genome map
AA seq 461 aa AA seqDB search
MESYWEEVKHIFKGRLASSAYQLWIEPLQASFGNAGEFFLDCPNPFFLHWVRNHYLSDLE
REYRLLTGGTTQIKLRLLKTPAKNKEDHSHRLQSCLPEISRPPSSGRLLNKAFTFEQFVV
GASNRFAFQASRALAGNDAFYGRTLFLTAQPGLGKSHLSQAVGNYIQTNYRHHQVFYLTA
EDFANEMVAALRQGAMAQFKDKFRRQCDTLLLEGVHFLSGKEKIQAELCYTLDCLADLNK
KLVFTSPYLPMEIPHLKQELLSRFTGGVITPIDPPDFSTRVSILTRKAQDRQVQVPREVK
EHLATYLTQDVRQMVSALDNLLLKAATLKTDINLDLANEVLRDFQAASQALRIEDIQKLT
GQVYQVSQEELLGKSRKKKIVKARNLAIYLSHHYLQKQLKDLARSFRRTHSTIIHSLECV
ERDLKVSAGFAAELQYLEERLQTSRRWRQSTLPQPKASTRN
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggagagttattgggaggaagtaaagcatattttcaaaggcaggctggcctcctcagct
taccagttgtggattgaaccattacaggcgtctttcggaaacgccggagagttttttctg
gattgccccaaccctttcttcctgcattgggtgcgcaaccattatctatccgaccttgag
cgggaatatcgcctcttgactggcggaacaacccaaatcaagttgcgccttctcaagacc
cccgctaagaataaagaggaccattcccatcgccttcagagctgtctcccagagatcagc
cgccccccaagctccggacgtctcctcaacaaggcctttaccttcgaacaatttgtcgtc
ggcgcctccaatcgcttcgcctttcaggcctctcgagccctggctggcaatgatgccttt
tatggcaggaccctctttctaacggctcagccagggctgggcaagagccatctctcccag
gccgtgggcaactatattcaaacgaactaccgtcatcatcaggtcttctatttaaccgcc
gaagatttcgccaacgaaatggtggcggctttgcggcagggggcgatggcgcagtttaag
gacaaattccggcggcaatgcgataccttattgttggagggggttcatttccttagcggc
aaagagaagattcaagccgagttatgttatactctggattgtctggcggacctgaataag
aagctggtcttcaccagcccgtatttgcccatggaaattcctcatctcaagcaggagttg
ctttcccgtttcaccggcggcgtcatcacccccatagaccccccggatttctccacgcgg
gtatctatcctaacccgaaaggcgcaggatcgtcaggtccaggtgccgcgcgaagttaag
gagcatttagccacctatctaacccaagatgtccgtcagatggtaagcgctctagataat
ctgctccttaaggcagccacgctaaaaactgacatcaatctggacttggccaatgaagtc
ctccgtgattttcaagccgcctcccaagctcttaggatagaggatattcagaaactaacc
gggcaggtgtatcaggtgagccaggaggagctcctcggtaagtctcgtaagaagaaaatt
gtcaaagccaggaatctggcgatttatctctcacaccactatctgcagaaacaactcaag
gacttggcgcgatccttccgacggactcattccaccattatccactccttggaatgtgtc
gaacgagatcttaaggtttcagccggttttgcggcggaactgcagtatttagaagagcgt
ctgcaaacctcgcggcgctggcgtcaatcgaccctaccccaacccaaggcctcaactcga
aattga

DBGET integrated database retrieval system