KEGG   Desulfobacca acetoxidans: Desac_0009Help
Entry
Desac_0009        CDS       T01454                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00240  Pyrimidine metabolism
dao00250  Alanine, aspartate and glutamate metabolism
dao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Desac_0009
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desac_0009
Enzymes [BR:dao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Desac_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEB07908
UniProt: F2NGK1
Position
8662..9624
Genome map
AA seq 320 aa AA seqDB search
MQTSKTRTMLFRRKDLLGLAGLSREEIQHILTTAASFKEISTRSIKKVPTLRGKTVITLF
YEPSTRTRTSFEIAAKRLSADTVNLSIAASSVVKGETLIDTANNLEAMHPDIIVIRHACS
GAPHLLAGRLKSSVVNAGDGLHEHPTQGLLDMLTVWEAKGRLDGLRVAIIGDIAHSRVAR
SNIHGFHTMGSQVVVAGPQTMLPPYLEALGVEVTYSLTEAVRQADVIMMLRLQLERQGQM
FFSTLREYSRVFGLNQKHLALAKPDALVMHPGPLNRGVEISPEVADGIQSAILQQVTNGV
AVRMAVLYLLSGGEQSGTAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaccagcaaaacaagaacaatgttgttcaggcgcaaagatcttttaggactggca
gggctcagccgggaggagatccagcatattttaacgactgcggcctctttcaaagagatt
tcgacccggagcatcaaaaaagtaccaaccctgcggggcaagacggtcattacgctgttc
tatgaacccagcacccgcacccgaacttcctttgagattgccgccaagcggttgagcgcc
gataccgtgaatctctcgattgcggccagcagcgtggtcaagggggagaccctgatcgac
acagctaataatttggaggccatgcacccggatattattgttatccggcacgcctgcagc
ggtgcaccccatctattggccggccggttgaaaagcagcgtcgttaacgccggggatggc
ctgcacgaacatcccactcaggggctgctggatatgctgaccgtctgggaggccaagggc
cggttggatggcctgcgggtagctattattggggatatcgcccattcgcgggtggcccgg
tccaatatccacggctttcacaccatgggctcccaggttgtggtcgccggaccacagacc
atgctgccgccgtacttggaggcattaggggtagaggtcacctattctctgaccgaggcg
gtgcgccaggcagatgtgattatgatgctgcgactgcagttggaacggcaagggcagatg
tttttttcgacattgcgtgaatactcccgggtttttgggctgaatcagaaacacttggcc
ttggccaaacccgatgccctggtgatgcatccgggacccttaaaccggggggtggaaatt
tcaccggaggttgcagatggcatccagtctgcgattctacagcaggtcaccaacggggtg
gcggtgcgcatggcggtcttatatctgttgagtggaggtgagcaaagtgggactgctgct
tag

DBGET integrated database retrieval system