KEGG   Desulfobacca acetoxidans: Desac_1355Help
Entry
Desac_1355        CDS       T01454                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00010  Glycolysis / Gluconeogenesis
dao00020  Citrate cycle (TCA cycle)
dao00620  Pyruvate metabolism
dao00633  Nitrotoluene degradation
dao00640  Propanoate metabolism
dao00650  Butanoate metabolism
dao00680  Methane metabolism
dao01100  Metabolic pathways
dao01120  Microbial metabolism in diverse environments
dao01130  Biosynthesis of antibiotics
dao01200  Carbon metabolism
Module
dao_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_1355
   00020 Citrate cycle (TCA cycle)
    Desac_1355
   00620 Pyruvate metabolism
    Desac_1355
   00640 Propanoate metabolism
    Desac_1355
   00650 Butanoate metabolism
    Desac_1355
  Energy metabolism
   00680 Methane metabolism
    Desac_1355
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desac_1355
Enzymes [BR:dao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desac_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_7 Fer4_9 Fer4_16 Fer4_2 Fer4_10 Fer4_4 Fer4_15 Fer4_17 Fer4_13 Fer4_8
Motif
Other DBs
NCBI-ProteinID: AEB09212
UniProt: F2NHM5
Position
complement(1565991..1566284)
Genome map
AA seq 97 aa AA seqDB search
MSKPLDQMTWQDIELGALLREPGNARAYRTGDWRSQHPVWTKSRCIRCGVCWTVCPEPAI
IQEPNGYFDMDPDYCKGCGICARECVTGCITMVPEEE
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagccgctagaccagatgacctggcaagatattgaattaggcgccctcctgcgt
gaacccggcaatgcccgagcttatcgcaccggcgactggcggtcgcagcacccggtctgg
accaaaagccgctgtatccgctgcggcgtctgttggactgtctgtccggaaccggccatt
atccaggagccgaacggctactttgatatggaccccgattattgtaaaggttgcggcatc
tgtgcccgtgagtgcgtcaccggctgcattactatggtaccggaggaagaataa

DBGET integrated database retrieval system