KEGG   Desulfobacca acetoxidans: Desac_1451Help
Entry
Desac_1451        CDS       T01454                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
dao  Desulfobacca acetoxidans
Pathway
dao03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Desac_1451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dao03011]
    Desac_1451
Ribosome [BR:dao03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Desac_1451
  Bacteria
    Desac_1451
  Archaea
    Desac_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 AAA_lid_6
Motif
Other DBs
NCBI-ProteinID: AEB09306
UniProt: F2NJD4
Position
complement(1655902..1656234)
Genome map
AA seq 110 aa AA seqDB search
MEIRAQAKFVHISPQKVRLVTRAIKDKKVDEALGALQFIPKKAARLVRRLVESAVANASQ
RSQVDVDSLFIKRAYVDGGPSLKRFMSRAMGRVNRIVKRTSHITVVLDEK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgagctcaagcaaaattcgttcatatctcgccccaaaaagttcggctcgtc
acccgggctatcaaggacaaaaaagttgacgaagcattgggggcattacaattcattccc
aaaaaagcggctcgcctcgttcgccggttggtggaatcggcagtggccaacgccagtcaa
cgttcccaagtcgacgtcgatagcctctttatcaaaagggcatatgtcgacggcgggcct
tcattaaaacgttttatgtcgagggccatggggcgagtcaatcgaatcgttaaacgcacc
agccacattaccgtggtgttggacgagaaataa

DBGET integrated database retrieval system