KEGG   Desulfobacca acetoxidans: Desac_2117Help
Entry
Desac_2117        CDS       T01454                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao00010  Glycolysis / Gluconeogenesis
dao00030  Pentose phosphate pathway
dao00051  Fructose and mannose metabolism
dao00680  Methane metabolism
dao01100  Metabolic pathways
dao01110  Biosynthesis of secondary metabolites
dao01120  Microbial metabolism in diverse environments
dao01130  Biosynthesis of antibiotics
dao01200  Carbon metabolism
dao01230  Biosynthesis of amino acids
Module
dao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desac_2117
   00030 Pentose phosphate pathway
    Desac_2117
   00051 Fructose and mannose metabolism
    Desac_2117
  Energy metabolism
   00680 Methane metabolism
    Desac_2117
Enzymes [BR:dao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Desac_2117
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Desac_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEB09946
UniProt: F2NK02
Position
2362512..2363615
Genome map
AA seq 367 aa AA seqDB search
MADKITLSVIKADVGGYVGHCAMHGELILEASRHLDDARSQGVLVDYHVTACGDDLELIM
THSHGVDNRDVHHLAWEVFEACTEVAKKLKLYGAGQDLLSHAFSGNVRGMGPGVAEMEFV
ERESEPIVIFMADKTSAGAWNLPLYKIFADPFNTAGLVIAPTLHAGFRYEVHDVKGHQKI
LFSTPEELYDLLVFIGATGRYLVKAVYTKDGEIAAVSSTERLALIAGKYVGKDDPVCVVR
CQGKFPAVGEVVEPFSMPHIVEGWMRGSHYGPLMPVPLSQARPTRFDGPPRVICLGFQLA
NGHLVGPCDIFDDPSFNEARRLCNVIADHLRRHGPFEPHRLPMDEMEYTTLPQVMAKLQD
RWQPLEN
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaaaattaccctgagcgtgatcaaagccgatgtcggcggctacgtggggcat
tgcgccatgcacggcgagctgattttggaggccagccgtcatttagatgatgcccgcagc
cagggagtcctcgttgactaccacgtcaccgcctgtggtgatgacctggaactcatcatg
acccactctcatggcgttgataatcgggatgtccatcatctcgcctgggaggtctttgag
gcctgcaccgaagtcgccaaaaaattaaagctctacggcgccggacaggacctgctgagc
cacgctttttccggcaatgtcagaggcatgggtccgggcgtggcagaaatggagtttgtc
gagcgcgagtctgagcccatcgttatctttatggctgataagacatcggccggggcctgg
aatttgcccctctacaagattttcgccgatccatttaataccgccggtctggtcatcgct
cccactctgcatgcaggttttcgctacgaagtccatgacgttaaaggtcatcagaaaata
ttattcagcactccggaggaactctatgatctcctggtttttatcggcgccaccggacgt
tatctagtaaaagcggtctataccaaagacggggaaatagccgccgtctcctctaccgag
cgactggctctaattgccggaaaatacgtcggtaaggatgatccggtctgtgtcgtccgc
tgccagggaaagtttcccgccgtcggagaggttgtggaacccttttccatgccccacatc
gtcgagggctggatgcgcggctctcattacggccccctcatgccggtcccgttatcacag
gcccgtcccacccgattcgatggccctccccgagttatatgcttgggtttccaactggct
aacggccacctcgttggcccctgcgatatttttgatgatcccagctttaatgaagcccgc
cgcctctgcaatgtcattgccgaccacctgcgccgccacggcccctttgaaccgcatcgc
ctgcccatggacgaaatggaatataccacgctgccccaggtgatggccaagctacaggac
cgttggcaacctctggaaaactag

DBGET integrated database retrieval system