KEGG   Desulfobacca acetoxidans: Desac_2325Help
Entry
Desac_2325        CDS       T01454                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dao  Desulfobacca acetoxidans
Pathway
dao03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Desac_2325
Enzymes [BR:dao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Desac_2325
DNA repair and recombination proteins [BR:dao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Desac_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 HHH_5 Helicase_RecD PIF1 T2SSE AAA HHH AAA_29 AAA_16 NTPase_1 DUF2075 HHH_2 AAA_28 AAA_23 UvrD-helicase RsgA_GTPase AAA_12 AAA_22 ABC_ATPase MMR_HSR1 Herpes_Helicase cobW ArgK ABC_tran Rad17 Zeta_toxin Mg_chelatase ATPase AAA_33 TrwB_AAD_bind AAA_18 SRP54 FtsK_SpoIIIE UvrD_C Auxin_inducible AAA_24 DUF3489 TsaE NACHT
Motif
Other DBs
NCBI-ProteinID: AEB10149
UniProt: F2NFN0
Position
complement(2578987..2581149)
Genome map
AA seq 720 aa AA seqDB search
MLVELQGQIERVTFFSEDTGFVVAQLKVRGQKHLVTIIGHLLAPKAGEGLRLKGEWSLHP
KYGEQFKFTEHETMTPATASGMKKYLSSGFIKGIGPVMAQRIVQKFGGQTFDIIETGIER
LAEVEGIGPKRRQMIQRAWEEQKQIREVMLFLQTHNISTAYAAKIFKQYGHQAVTVMQEN
PYQLAADIFGIGFLTADRIAMKLGFEKETPARLEAGILHTLKNVSNEGHVFFPYRPLLEK
AREILAVEEQLIVQALSRLAFRQEVVVEESLDQDQRPVYLSGFYLAETNAAKRLKALMQA
QQQLPFIEPAKALAWVQERLGLTLAPQQADAVTMSLRHKVLLITGGPGTGKTTIINAILK
IWERLGVNVMMAAPTGRAAKRMSEVTGWEAKTIHRLLQYSQQKGGFQVSEGKTLPCDLLI
IDEASMIDVVLLHHLLKATPRGATLILVGDANQLPSVGPGNVFRDLIASGTIPLVELTEI
FRQAQESLIIVNAHRINRGQLPQWKAEPDKLADFFFLEQEEPQEVLHLVLELVKERIPKR
FGFDPVEDIQVLTPMHRGVVGAGMLNQTLQRELNPDGPGLDRGGRMFKVNDKVMQIRNNY
DKDVFNGDIGRISRIDQEMQELTIIFENREVIYDFGELDEIVLAYAISVHKSQGSEYPAV
VLPMVTQHYLLLQRNLIYTAVTRGKKLVVIVGAKKALAMAIHNDKTKKRHSRLGARLAAG
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgctggtggaacttcaggggcagattgagcgggtcacgttttttagtgaagacaccggc
tttgtggtagctcaactcaaggtgcgcggtcaaaaacatctagtgaccataatcggccac
ctgttggcgcccaaagcaggcgaggggctgcgtttaaagggagaatggagtctccacccc
aaatacggtgaacagttcaaattcaccgagcacgaaaccatgactccggctactgcctct
ggtatgaaaaaatatctgagttccggttttatcaagggaatcggaccggttatggcgcag
cgcatcgtccagaaattcgggggccagacctttgatatcattgagaccgggattgagcgg
ttggcagaagtagagggcatcggtcccaagcggcgccagatgatccagcgggcctgggag
gaacagaaacagatccgggaggtgatgctgttcttgcagacgcacaacatcagcaccgcc
tatgcagccaagatcttcaagcagtacgggcaccaggccgtcactgttatgcaggaaaat
ccttaccaactggccgccgatatcttcggcatcggttttcttaccgccgaccgcattgcc
atgaaattgggttttgaaaaagagactccggccagattggaggctggcatcctccatacc
ctaaagaacgtgagtaacgaaggacatgtattctttccctatcgaccgctgttggaaaag
gcccgtgagattctggcagtcgaggagcagttgattgtccaggcactcagccgtctggcg
tttcggcaggaggttgtggtcgaggagtccctggatcaagaccagcggcccgtctacttg
agcggtttttatctcgccgagactaatgccgccaaacgccttaaggccttgatgcaagcc
cagcagcagctcccttttatagagcctgccaaggccctcgcctgggtgcaggagcgtctg
ggcctcactctggcgccccagcaggccgatgccgttaccatgtctttgcgtcataaggtg
cttctcatcaccggcggtccgggtaccggcaagaccactatcatcaacgctattttgaag
atttgggagcgcttgggggtgaatgtcatgatggcggcgcccaccggtcgggccgccaaa
cgcatgagcgaggtcaccggctgggaggccaagaccattcatcggttgctgcagtatagc
caacagaagggtgggtttcaggttagcgaaggaaagaccttgccctgcgacctgctgatc
atcgatgaagcctccatgatcgatgttgtcctcctgcaccaccttttgaaggctacacct
cggggggccaccctcatcctggtaggcgacgccaaccaactgccatcggtgggtccgggc
aatgtcttccgcgacctgatcgcttccggcacaattcctttagtcgagctaaccgaaatc
tttcggcaggcccaggaaagcctgatcatcgtcaacgcccaccggatcaaccgcgggcag
ttgccgcaatggaaagccgagcccgacaaattagctgattttttcttcctggagcaggaa
gaaccgcaagaagtcctgcacctcgttctagaattggtcaaggagcgcataccgaagcgt
ttcgggtttgatccggtggaggatattcaggtccttacgccgatgcatcggggcgtggtg
ggggccggaatgctcaaccagactctgcagcgggaactcaaccccgacggtccgggactt
gaccgtggggggcgaatgttcaaagtcaatgacaaagtgatgcagatcaggaataactat
gacaaggatgtcttcaatggcgatatcggccgcatcagccgcattgaccaagagatgcaa
gaattaacgattatctttgagaaccgtgaagtaatatacgatttcggtgaattggacgaa
attgtcctggcctatgctatttcagtacacaaatctcaagggtcggaatacccggcggtg
gtgctgccgatggtaacccagcattatctgctgctgcagcgcaacctgatttatacggcg
gtgacacgcggcaagaagctcgtagtcatagtcggggccaagaaggcattggccatggca
atacataacgataagactaaaaaacggcactccaggctgggggcacggctggcggcaggg
taa

DBGET integrated database retrieval system