KEGG   Desulfobacca acetoxidans: Desac_2643Help
Entry
Desac_2643        CDS       T01454                                 

Definition
(GenBank) Methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase trmFO
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
dao  Desulfobacca acetoxidans
Brite
KEGG Orthology (KO) [BR:dao00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dao03016]
    Desac_2643
   03036 Chromosome and associated proteins [BR:dao03036]
    Desac_2643
Enzymes [BR:dao01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     Desac_2643
Transfer RNA biogenesis [BR:dao03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Desac_2643
Chromosome and associated proteins [BR:dao03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Desac_2643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA NAD_binding_8 FAD_oxidored AlaDh_PNT_C FAD_binding_2 DAO Pyr_redox_2 Pyr_redox HI0933_like FAD_binding_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEB10458
UniProt: F2NDW1
Position
complement(2910491..2911798)
Genome map
AA seq 435 aa AA seqDB search
MTNPALINIVGGGLAGAEAAWQAQRQGVRVCLFEMKPERFSPAHQSPLLGELVCSNSLRS
EAPDSAIGLLKNELRRLGSLIMGAAAASRVPAGKALAVDRQAFARFITEALAEQPDVEIV
RQEVTALNFSEPAVIATGPLTTDSMAESLRELTGREQLHFYDAISPIVFADSINHDIVFR
ASRYGAGDDYLNCPLTEADYQTFYQALTTAELMPLRTFEEARFFEGCLPIEVMAARGYQT
LLFGPMKPVGLMDPHTGRQPFAVVQLRQENREGELYNLVGFQTRLKYGEQRRVLRLLPGL
EQAEFARLGSVHRNTFIHSPGLLTRFLNFAARPQLFLGGQITGVEGYLESTAMGWLAGVN
AARLARQQPLLSPPPETAMGALVRHITNTEVRDFQPMNVNFGLFPALPGRVPKKGRGAAY
AQRALEALEAWLARL
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ttgacgaacccggcactgattaatattgtcggcggaggcctggcgggggcggaagcggcc
tggcaggcgcagcgtcagggtgtacgggtgtgcctgttcgagatgaagccggagagattt
tctccggcacatcagtcacccctgttgggtgagctggtctgcagcaactccctgcgctcg
gaggcacctgacagcgccatcggtctgttgaaaaatgaactgcgccgcttgggttcgctg
atcatgggggcagcagcggcgagtcgggtgccggcaggcaaggccctggccgtggatcgg
caggcctttgccagattcattaccgaggcattggcagaacagccggacgttgagattgtc
cggcaggaagttacggccctgaatttttccgaaccggcggttatcgctaccggtccgctc
acgaccgattccatggcggagtcattgagggagctgaccggcagggaacagttgcatttc
tatgacgccatctctcccattgtctttgctgattccatcaaccacgacatagtcttccgg
gcctcccgctatggggcgggggacgattatctcaactgtcccctgacggaagcggattat
cagactttttatcaggccttgactacggctgagctgatgccgctgcggacattcgaagag
gcccgtttttttgaggggtgtctgcctatcgaagtcatggcggctcggggatatcagacc
ctgctcttcggacccatgaaaccggtgggtttgatggacccccacaccggtcggcagcct
tttgcggtagtgcagcttcgccaggaaaaccgggaaggagaactctataatctggtaggg
tttcagacgcgtctgaaatacggggaacagcggcgggtgctgcggctcctgccgggattg
gagcaggcagaatttgcccgtttggggagcgtgcaccgcaatacctttatccactcccct
ggactactcacccgcttcctgaattttgctgccagaccgcagctcttcctgggggggcag
ataaccggcgtagaggggtatctggagtccaccgctatgggctggctggccggggtcaac
gccgcccgcctagcccggcagcagccgctgctcagcccgccgccggaaacggccatgggg
gccttggtgcgccatattacaaatactgaggtcagggattttcagccgatgaatgtgaat
ttcggcttattccctgcgttgccgggccgggtgccgaagaaggggcgcggcgcggcgtat
gcccaacgggccctggaggccctggaggcgtggctggcgaggctttga

DBGET integrated database retrieval system