KEGG   Denitrovibrio acetiphilus: Dacet_0873Help
Entry
Dacet_0873        CDS       T01189                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00010  Glycolysis / Gluconeogenesis
dap00030  Pentose phosphate pathway
dap00051  Fructose and mannose metabolism
dap00052  Galactose metabolism
dap00230  Purine metabolism
dap00500  Starch and sucrose metabolism
dap00520  Amino sugar and nucleotide sugar metabolism
dap00521  Streptomycin biosynthesis
dap01100  Metabolic pathways
dap01110  Biosynthesis of secondary metabolites
dap01120  Microbial metabolism in diverse environments
dap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacet_0873
   00030 Pentose phosphate pathway
    Dacet_0873
   00051 Fructose and mannose metabolism
    Dacet_0873
   00052 Galactose metabolism
    Dacet_0873
   00500 Starch and sucrose metabolism
    Dacet_0873
   00520 Amino sugar and nucleotide sugar metabolism
    Dacet_0873
  Nucleotide metabolism
   00230 Purine metabolism
    Dacet_0873
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dacet_0873
Enzymes [BR:dap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Dacet_0873
    5.4.2.8  phosphomannomutase
     Dacet_0873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Transposase_22
Motif
Other DBs
NCBI-ProteinID: ADD67652
UniProt: D4H606
Position
complement(913803..915260)
Genome map
AA seq 485 aa AA seqDB search
MLRGKDIFRKYDIRGVYGKTLNCNTAESAAKAFATQVISETGEKHPTLSVGRDVRESSSD
LFEAVCNGLTSSGVNVVDLGVCPSPLAYFSMYSEQTDGYIMITGSHNPPEFNGIKVGTKN
TVYHSEKIEQIYTDIIMKNFPKTDKKGFIRIADIKIDYINYLNEHFKALKDQIKKLSYIP
KIVIDAGSGTASDIAPVIFKNLGVEVHELYCTPDGSFPGHHPDPTVESNMAEAKELLLKI
GADFAVGFDGDADRLGALDNKGRMMWGDQLIGVFAHDIAQHNQGRKIVADVKASKGLYEH
IEAIGMVPVMYLSGHSMIKEKMKQEKAVLGGEMSSHFFFADRYFGFDDGIYASVRLLEAY
VKMLTNGTIRCSADMTDIIPAYINTPEIRKKCQDEVKFQIIKELERKFIKYLRDNTYEIT
DIISIDGLRITFDSGWALIRASNTEPLLVTRYEAVSKKDLHNIRQIVEREIKETKYDIQK
KDQTG
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtggcaaagacatttttcgtaagtatgacatacgaggcgtttacggaaaaact
ctcaattgcaataccgctgaatcagcggcaaaagcatttgctactcaggttatatccgaa
accggggaaaaacacccaactctctctgtcgggcgggatgtaagagagtcatcctcagac
ctcttcgaggctgtctgcaacgggcttacctcttcgggggtaaatgttgtcgatcttggt
gtatgcccctcccctctggcgtatttcagcatgtacagcgaacagacagacggttatata
atgattaccggaagccataacccgccggagttcaacggcataaaagtcggcaccaaaaat
actgtctatcactcagaaaagatagaacagatatacacagatatcataatgaaaaacttc
cctaaaactgataaaaaaggatttatccgaattgcagacataaaaatagattacataaat
tacctgaacgaacatttcaaagctcttaaagaccagatcaaaaaactttcttacattccc
aaaatagtaattgatgcaggcagcggaactgcttcggacatcgctccggtcatcttcaaa
aatttgggagtggaagttcacgaactttactgcacacctgacggttcatttcccggtcat
caccccgaccccactgttgaaagcaatatggcagaagcaaaagagcttctgttaaagatc
ggggctgacttcgctgtcggctttgacggtgatgcggacaggcttggcgccctcgacaac
aaagggcgtatgatgtggggagaccagctcataggtgtatttgcacatgatatagcccag
cataatcagggtagaaaaattgtcgctgatgttaaggcgagcaaagggctttatgagcac
attgaagctatcgggatggttcctgtgatgtacctgtcaggacattctatgattaaagaa
aagatgaaacaggagaaagctgtcctcggcggtgaaatgagctcccattttttctttgca
gacagatattttggcttcgatgacggcatatatgcatctgtcagactcctcgaagcatac
gtaaagatgctcacaaacgggacaatcagatgctctgccgacatgacagatataatcccc
gcatacataaacactccggagataagaaaaaagtgtcaggatgaagttaaatttcagatt
atcaaagaactcgaaagaaaattcataaaatatctgcgtgacaatacttatgaaataaca
gatattatcagcatagacggattgcgcataacctttgatagcgggtgggcgcttataaga
gcaagcaacacagaaccccttctcgttaccagatatgaggctgtcagcaaaaaagatctg
cacaacataagacaaatagttgaaagagagattaaagaaactaaatatgatatacagaaa
aaagaccagacaggttaa

DBGET integrated database retrieval system