KEGG   Denitrovibrio acetiphilus: Dacet_1474Help
Entry
Dacet_1474        CDS       T01189                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dap00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dacet_1474
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dap02022]
    Dacet_1474
Two-component system [BR:dap02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Dacet_1474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ADD68244
UniProt: D4H895
Position
1530084..1530788
Genome map
AA seq 234 aa AA seqDB search
MSHNILIVDDDIKLCKMLSRYLRDYSYSVDVINNPLMLEKYLKSSKPSVIILDIMMPHIN
GFDLCKKLRKNSDIPVIMLSARGEVEDRIAGLEAGADDYLAKPFEPRELIARIYAVIKRF
EHSEDTANNAAVYQYGELSIDTDKYKATMDGSNLELTKTEFIILSLMVRNPYILLSRDRL
YNELTGFDCDAYNRTVDISVSRLRTKLNDDPKSPKYIKTVWGEGYMFIADKLDT
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacaatattttgattgttgatgacgatattaagctatgcaaaatgctaagcagg
tatttacgtgactattcatactcagtggacgtaattaacaacccgctgatgcttgaaaaa
tatctcaagtcatcaaaaccgtcagtaattatacttgatataatgatgccacatataaac
ggctttgatctttgtaaaaagctgagaaaaaactctgacataccggttataatgctttca
gcgagaggcgaagtagaagatagaattgcaggcttggaagctggtgccgatgattatctc
gccaagccttttgagccgagagagcttatcgccagaatttatgctgtgattaaacgcttt
gagcattcagaggacactgcaaacaatgccgctgtttatcagtacggagaactttctatt
gatactgataagtataaagcgactatggatggcagtaaccttgagcttacaaaaacagaa
tttataatattatcattaatggtgcgcaatccgtacattctcctgagcagagatagactg
tataatgagcttactggatttgactgtgatgcatataacagaacagtcgacatttctgtg
agcagattgcgaaccaaacttaacgatgacccaaaatcaccaaaatatatcaaaacggtt
tggggagaagggtatatgtttattgctgataaattggatacttaa

DBGET integrated database retrieval system