KEGG   Denitrovibrio acetiphilus: Dacet_1560Help
Entry
Dacet_1560        CDS       T01189                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00230  Purine metabolism
dap01100  Metabolic pathways
Module
dap_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dacet_1560
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Dacet_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 RsgA_GTPase AAA_22 MobB ABC_tran AAA_33 AAA_30 Thymidylate_kin NTPase_1 AAA_16 ATP_bind_1 cobW
Motif
Other DBs
NCBI-ProteinID: ADD68329
UniProt: D4H8I0
Position
complement(1619790..1620401)
Genome map
AA seq 203 aa AA seqDB search
MRFNKGKLFVVSAPSGAGKTTLCNRLLGRFDTIGYSVSYTTRKPRHDETDTEDYYFVDET
AFKGMIDRDEFLEWAQVHGNYYGTSRIRVEEILGTGRDVLLDIDPKGARQLREKLDYGIY
IFITAPSMKDLRTRLVNRRTESEEIMKVRLDNAREEIRHIHEYDYIIVNSEINKATNELE
AVYIAEHLKADTIETIEDIMEVD
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttaataaaggcaagttatttgtcgttagtgcccccagcggtgcaggaaagaca
actttatgtaatagattgctaggcagattcgatacaataggttattctgtctcctacacc
acgagaaaaccacgccacgatgaaacagacaccgaagattattactttgtagacgaaacg
gcttttaagggtatgatagacagagatgagtttctcgaatgggcacaggtgcacggtaat
tattacggcacatccagaattcgtgtggaagagatactcggcacaggcagagatgttctg
cttgatatcgacccgaaaggggcacgtcagcttcgggaaaagcttgattacggcatatat
atttttatcaccgcaccttctatgaaagacttgcggacaaggcttgtaaacagacgcact
gaaagcgaagagattatgaaagtcaggctggataatgccagagaagaaattcgacatatc
catgagtatgactatattattgtaaacagcgagatcaacaaagccacaaacgagctggaa
gcggtatatatcgcagagcacctcaaggctgatactatagaaacaattgaagacattatg
gaggtagactaa

DBGET integrated database retrieval system