KEGG   Denitrovibrio acetiphilus: Dacet_1839Help
Entry
Dacet_1839        CDS       T01189                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00040  Pentose and glucuronate interconversions
dap00052  Galactose metabolism
dap00500  Starch and sucrose metabolism
dap00520  Amino sugar and nucleotide sugar metabolism
dap01100  Metabolic pathways
dap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dacet_1839
   00052 Galactose metabolism
    Dacet_1839
   00500 Starch and sucrose metabolism
    Dacet_1839
   00520 Amino sugar and nucleotide sugar metabolism
    Dacet_1839
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dacet_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 DUF3137
Motif
Other DBs
NCBI-ProteinID: ADD68603
UniProt: D4H0U0
Position
complement(1940355..1941224)
Genome map
AA seq 289 aa AA seqDB search
MKVRTAVFPVAGLGTRLLPATKSMPKEMVTLIDRPLIQYAVEEVIDAGVERVVFVSARSK
KALEDHFDRTPELEYQLEEAGKEDVLKDVQKLSSMCDIIYIRQKEPLGLGHAVLCAKDIV
GKEPFAVILPDDIISSKEPVTGQLIKRYTQTGKSVVSLMEVPDEDTSKYGIVKLGREEDK
GLFKLDGMVEKPKSNPPSNMAIIGRYILTPEVMAALETTKRGAGGEIQLTDAILDVAKSE
GVYGYLFEGDRFDCGNMYGLFEAVVNFALERKDLREHAVKVIQEAAKRF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaagaacagcagtttttcctgtagcaggtcttggaacaaggcttcttcctgca
acaaagtctatgcctaaggagatggtcacgctcatcgacagaccactgatccagtatgct
gttgaagaggttatagatgcaggtgtcgaaagggttgtttttgtctcggctagaagcaaa
aaggctctggaagatcactttgacagaactcctgagttggaataccaacttgaggaagcg
ggcaaagaagatgtgctgaaggatgtgcagaagctttcgtcaatgtgcgatataatatat
atacgtcagaaagagcctttgggactggggcatgcggtgctctgcgcaaaggatatagta
gggaaagaaccctttgcggttattctgccggatgacataataagcagcaaagaacctgtt
accggtcagctcattaaaagatatacccagacgggaaagtcagttgtgtcactcatggaa
gtacccgacgaagatacttctaagtatggcatagtaaagctgggcagagaagaggataag
gggctgtttaagcttgatggtatggtggaaaagcctaaaagcaatccaccgtcaaatatg
gctattataggcaggtatattcttacccctgaagttatggcggctcttgaaactacaaaa
aggggcgcaggcggtgagatacagcttacagacgctatacttgatgttgcaaagtcagaa
ggtgtttacggatatcttttcgaaggggacagatttgactgtggcaacatgtacggactt
tttgaagcggttgtgaattttgctctggagagaaaagacctcagagaacacgctgtcaaa
gtgattcaggaagcggcaaaacgtttctaa

DBGET integrated database retrieval system