KEGG   Denitrovibrio acetiphilus: Dacet_2223Help
Entry
Dacet_2223        CDS       T01189                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00010  Glycolysis / Gluconeogenesis
dap00052  Galactose metabolism
dap00500  Starch and sucrose metabolism
dap00520  Amino sugar and nucleotide sugar metabolism
dap00521  Streptomycin biosynthesis
dap01100  Metabolic pathways
dap01110  Biosynthesis of secondary metabolites
dap01120  Microbial metabolism in diverse environments
dap01130  Biosynthesis of antibiotics
dap01200  Carbon metabolism
Module
dap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dacet_2223
   00052 Galactose metabolism
    Dacet_2223
   00500 Starch and sucrose metabolism
    Dacet_2223
   00520 Amino sugar and nucleotide sugar metabolism
    Dacet_2223
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dacet_2223
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dacet_2223
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dacet_2223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADD68985
UniProt: D4H2W2
Position
2356494..2357381
Genome map
AA seq 295 aa AA seqDB search
MFLCFDIGGTNIKSCLTNASGVCADKAVTPTPNSYTELMNVLTGIAENAEFEACAVAVPG
TCAPKSGETIFAPNLPCINGKNIKNDLQNTTRKPVFIENDANLAALGEYYFVEKNNISSM
VFLTIGTGLGGGAVLNGELLTSDISLFEAGHINIEPDGRPCGCGKKGCLEAYVNTSGILE
TYHMLSAHGHADNVNMVYSASKTGDKAAALTFEVFGGYLGIGMASLANILVPEKIKIGGG
ISEMSDAFLGHTLKVFAKNIYPAYRNRVSIELSTLKNSAGLKGCAALCLTQLSKN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtttctctgttttgacataggcggaacaaatataaaatcctgcttaacaaatgcttcc
ggcgtatgtgcagacaaagctgtcacgcccacaccaaattcatataccgagctcatgaac
gttctgaccggcattgctgaaaatgctgaattcgaagcctgtgctgttgctgtccccggg
acatgcgcacccaaatcaggcgaaaccatctttgccccgaatctgccttgtataaacggc
aagaatatcaaaaatgacctgcaaaacactaccagaaaacctgttttcatagaaaacgat
gcaaacctcgcagcactgggagaatattactttgtcgaaaaaaataatatcagcagtatg
gtattcctaaccataggaacagggcttggcggcggtgcagtcttgaacggagaactgctt
acgtcagacatttcgctttttgaagcgggacatataaacatcgagccggacggcaggccc
tgcggatgtggtaaaaagggctgcctcgaagcatatgtaaataccagcggaatacttgaa
acttatcacatgctgtcagcacacgggcatgcagacaatgtaaacatggtttatagcgca
agcaaaaccggagacaaagccgcagcacttacttttgaggtcttcggcggatatctcgga
ataggtatggcaagtctcgccaatatacttgtaccggaaaagataaaaataggcggaggt
atatcagaaatgtctgatgcctttctcggtcatacactaaaggttttcgctaaaaacatc
tacccagcctatcgcaacagggtttccatagagctctcaactcttaaaaactccgcagga
ctcaaggggtgtgcagctctctgcctgacacaactcagcaaaaactga

DBGET integrated database retrieval system