KEGG   Denitrovibrio acetiphilus: Dacet_2680Help
Entry
Dacet_2680        CDS       T01189                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap00051  Fructose and mannose metabolism
dap00520  Amino sugar and nucleotide sugar metabolism
dap01100  Metabolic pathways
dap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dacet_2680
   00520 Amino sugar and nucleotide sugar metabolism
    Dacet_2680
Enzymes [BR:dap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Dacet_2680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADD69435
UniProt: D4H579
Position
2850240..2851649
Genome map
AA seq 469 aa AA seqDB search
MINFLLCGGSGTRLWPISRKNFPKQFCKLIGEQSLFQNTISRNLPNCSRQMIIANKENVF
MAMDQIEEAKGTGAGVRYVLEPVGRNTAPAIALGCFYCDPDDVILVTPTDHMIQKLDIYE
ETLQMAQDAAKAGYIVTFGIMPTAPETGYGYIESEESSEPVRKVVCFKEKPDAKTAQEYV
DSGRFYWNSGMFCFTAKVFLEELEKYAPEIYNKSKKAFEASLIEDEVCNVDMDDMLAIPS
DSIDYAVMEKSDCVKVIPSSFVWNDVGSYDALETELPSTEDGNTDLDHHISINSKNNMIY
SDKVIATVDVEDLIIVDTIDAMLIAKKGSSQKVKDVVNMLNKRGKSDKKYSQLTEIHTTA
YRPWGSYTVLEEHPRFKMKRIVVKPGKRLSLQKHHHRSEHWVVVSGSALVTKGSEEIFLK
PNESVYINMGEVHRMENQGMIDLVFLEVQVGEYLGEDDIVRLEDDYDRS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattttttactttgtggtggaagcggaacaaggctatggcctatctccagaaaa
aacttccctaagcaattctgcaagttaataggtgaacaatctctgtttcagaacacgata
tccagaaatctacctaactgttccagacagatgattattgctaataaagaaaacgtattc
atggctatggatcagatagaagaagcaaaggggacaggtgcaggtgtgcgctatgtgctg
gagcctgttggacgaaacacagctcctgctatcgctctgggctgtttctattgcgaccct
gacgatgtgatcctcgtgacacccacagaccacatgatccagaagctggacatatacgaa
gagaccctgcagatggcgcaggatgcagcgaaagctggctatattgttacattcggtata
atgcctactgcaccagaaactggctatggttacatcgagagtgaagagagcagcgaacct
gtgcgtaaggttgtctgctttaaagagaagccggatgcaaaaactgctcaggagtatgtc
gactccggcagattctattggaacagcggtatgttctgtttcactgctaaagtcttcctc
gaggagctggaaaaatatgctccggaaatttataacaaaagtaaaaaggcctttgaggct
agcttgatagaagacgaagtatgcaacgttgacatggacgacatgctggctatcccatca
gacagcatcgactatgctgttatggagaagagtgactgtgtgaaggtcatcccttcatcc
tttgtgtggaatgacgtgggcagctatgacgctctggagacggagcttccatctacagaa
gatggcaataccgatctggaccatcacatcagcatcaattccaagaacaacatgatatat
tccgataaagttatcgccactgtggatgtcgaggatctgatcattgtcgacaccatagac
gctatgctgatagcgaagaaaggcagctcccaaaaggtaaaagatgtagtaaacatgctg
aacaagcgtggaaaatcagataaaaaatactctcagctcactgagatacacaccacggct
tatcgcccttggggatcctacacagtgctggaggaacacccaagatttaagatgaagcgc
atagtcgtgaagccgggtaagaggctctctctgcagaaacaccatcaccgtagcgagcac
tgggttgttgtcagcggctctgctctggtgacaaaaggctcggaagaaatctttctgaag
cctaatgagtctgtatacatcaacatgggtgaggtacaccgcatggaaaaccaaggcatg
atcgaccttgtattcctcgaggtacaggtaggcgaatatcttggagaagacgacatagtc
aggctggaagatgactatgacaggagctag

DBGET integrated database retrieval system