KEGG   Denitrovibrio acetiphilus: Dacet_2849Help
Entry
Dacet_2849        CDS       T01189                                 

Definition
(GenBank) response regulator receiver modulated CheB methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
dap  Denitrovibrio acetiphilus
Pathway
dap02020  Two-component system
dap02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dap00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dacet_2849
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dacet_2849
Enzymes [BR:dap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dacet_2849
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Dacet_2849
Two-component system [BR:dap02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dacet_2849
Bacterial motility proteins [BR:dap02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dacet_2849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg Phage_TAC_9 DXP_reductoisom
Motif
Other DBs
NCBI-ProteinID: ADD69599
UniProt: D4H6C5
Position
3036395..3037465
Genome map
AA seq 356 aa AA seqDB search
MPKVKLLIVDDSAFMRKAIENMVKKDPEIVIVGTAKNGIEAVEQVKTLRPDVITLDIEMP
RMDGLTALQKIMAENPLPVIMVSSLTTEGAEATLKALDLGAVDFIPKDKSFASFGVMKIE
DQLIAKVKGFGAKKMFFRRPSLARPSMPSSTITKPTTPPRPAPKITSKKKLVIIGTSTGG
PQSLQKVIPLLPGDLGVPILVVQHMPPNFTKSLAQRLNSLSKLTVLEAQGKEKLEPNHVY
IAKGGTHMKIKKMGPHFYTEVGTEPSNTLHIPSVDVTAASVAETIGRDALGVIMTGMGSD
GMKGLQLLKLKGGSVIAQDEESCIVYGMPRAVVEAGFNDEVVPLTEIYQRIVAYCR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaagttaagctgctgattgtggatgactccgcattcatgagaaaagccatagaa
aatatggtaaaaaaagaccccgaaatcgttattgtcggtacagcaaaaaacggtatagag
gctgtggagcaggttaaaacactcagacctgacgttataactcttgatatagaaatgccc
cgcatggacggtctcactgctctgcaaaaaatcatggcggaaaatccccttccggtgatt
atggtcagctccctcacaacagaaggtgcagaagcaacacttaaagctctggatctagga
gctgtggacttcatccctaaagataagtcatttgccagtttcggcgttatgaagatagag
gatcagctcatcgcaaaggtgaagggcttcggtgcgaaaaagatgtttttcagaagacca
tcactcgcaagaccttctatgccttcatcaactataaccaaaccgactacaccacccaga
cctgcaccaaagataacttccaaaaagaagctggttatcataggtacatcaacaggaggt
ccgcagtcacttcagaaagtaatacctctgcttccgggagacctcggtgtcccgatactt
gttgtgcagcatatgcctccgaattttacaaaatcactagctcagaggcttaattccctc
agcaagctcacggtgcttgaagcacaagggaaagagaagcttgagccgaaccatgtgtac
atagcaaaaggcggaacccacatgaagataaaaaagatgggaccgcacttctatacagaa
gtcggaactgaaccgtcaaatacactgcacataccaagcgtggatgtaacagcagcatct
gttgcagagacaataggacgtgacgcacttggcgttataatgacaggcatggggagcgac
ggcatgaaaggtctccagctccttaagctgaagggcggcagtgtgatagctcaggatgaa
gaatcctgtatagtctacggtatgcccagagctgtagtggaagcaggatttaatgacgaa
gttgtgcctcttactgaaatttatcagcgtatagtggcatattgcagatag

DBGET integrated database retrieval system