KEGG   Dickeya aquatica: DAQ1742_00032Help
Entry
DAQ1742_00032     CDS       T06021                                 

Gene name
yihX
Definition
(GenBank) Alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
daq  Dickeya aquatica
Pathway
daq00010  Glycolysis / Gluconeogenesis
daq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:daq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAQ1742_00032 (yihX)
Enzymes [BR:daq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DAQ1742_00032 (yihX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Acid_PPase SHOCT Hydrolase_like HAD Phage_GPD
Motif
Other DBs
NCBI-ProteinID: SLM61177
UniProt: A0A375A5C2
Position
34705..35316
Genome map
AA seq 203 aa AA seqDB search
MLYIFDLGNVVIDVDFNRVLGVWSSLSGAPLATLRERFTMGHTFEQHERGEISDEEFASR
LCHEMGISLSFEQFSAGWQAIFHGIRKDVIDIMYRLRQEGHRVVILSNTNRLHCQCWPAL
YPDVIPAADKLYLSQEMGYRKPEAAIYQQVLREEGVSAADACFFDDNPANIDAAQSLGIR
AILVSDRQVVPDFFASQVFSQEA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatatctttgatttggggaatgtcgtcattgatgtcgattttaaccgggtgctg
ggtgtgtggagcagcctgagtggtgcgccactggcgacactgcgtgagcgttttaccatg
gggcatacctttgaacagcatgagcgcggtgaaattagcgatgaagagtttgcgtcacgg
ctgtgccatgaaatggggatttcgcttagttttgaacaattttcggctggctggcaggct
attttccacggtattcgcaaagatgtgatcgacatcatgtaccgcttacggcaggaagga
caccgtgtcgtcatactctcgaataccaatcggcttcattgccagtgctggccagcactt
tacccggatgtgatacccgctgccgataaactctatttatcgcaggagatgggttatcgc
aaaccggaagcggcgatttaccagcaagtgttgcgagaagaaggtgtaagtgccgctgat
gcctgcttttttgacgataatcctgccaatatcgacgctgctcaatctttggggattcgg
gcaattttggtcagcgatcggcaggtggtgcctgatttttttgccagccaggtttttagc
caggaggcgtaa

DBGET integrated database retrieval system