KEGG   Dickeya aquatica: DAQ1742_00975Help
Entry
DAQ1742_00975     CDS       T06021                                 

Gene name
rluD
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
daq  Dickeya aquatica
Brite
KEGG Orthology (KO) [BR:daq00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:daq03009]
    DAQ1742_00975 (rluD)
Enzymes [BR:daq01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     DAQ1742_00975 (rluD)
Ribosome biogenesis [BR:daq03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DAQ1742_00975 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 CT47 TruB_N S4_2
Motif
Other DBs
NCBI-ProteinID: SLM62022
UniProt: A0A375A7C5
Position
975978..976877
Genome map
AA seq 299 aa AA seqDB search
MFPDYSRSRIKTWILDQRVQINGNMVDRPKEKVLGGESVAIDALIEEEERWEAQHIELDI
VYEDDDILVINKPRDLVVHPGAGNPDGTVLNALLHHYPAIADVPRAGIVHRLDKDTTGLM
VVAKTVPAQTRLVEALQAREITREYEAVAIGTMTAGGTVDEPIARHSTKRTHMSVHPMGK
PAVTHYRIMEHFRAHTRLRLRLETGRTHQIRVHMAHINHPLVGDPLYGGRPRLPKGASAE
FIEALRNFDRQALHATMLRLYHPISGIQMEWHAPLPQDMVCLINALKADTEAFKDQLDW
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
ttgttccctgattattctcgttctcgcataaaaacgtggattctggatcaacgcgtacag
attaacggcaatatggtcgatagaccaaaagagaaagtgcttggcggggaatctgtcgcc
attgatgccttgattgaagaagaagaacgctgggaagcgcagcatattgaactggatatt
gtgtatgaagacgacgatatcctggtgattaacaaaccgcgtgatttggttgtgcacccc
ggagcaggcaacccggatggcacggtactcaacgcgctgttgcatcattacccggcgatt
gccgatgtgccacgcgccggtattgtgcatcgcctggataaagacaccaccgggttgatg
gtggttgccaaaacggttcccgctcagacccgattggtggaagcattgcaggcacgcgag
attacacgcgaatatgaagcggtcgcgattggtaccatgaccgccggtggtacggtagat
gagccgattgcgcgtcattccaccaaacgtacgcatatgtcggtgcacccaatggggaag
cctgccgttacgcattatcgcatcatggagcatttccgtgcacacacccgcctgcgcctg
cggctcgaaaccggcagaacgcatcagattcgtgtgcatatggcgcacattaaccatccc
ttggtgggggatcctctgtatggtggccgcccgcgtttgccaaaaggcgcgtccgccgaa
tttatcgaggcgctgcgcaactttgaccgacaagccttgcatgccaccatgttgcgcttg
tatcaccctatcagtggcatccaaatggagtggcatgcgcctctgccacaggatatggtc
tgcctgattaatgcactcaaggcggatacagaggcatttaaagatcaacttgactggtga

DBGET integrated database retrieval system