KEGG   Dickeya aquatica: DAQ1742_01337Help
Entry
DAQ1742_01337     CDS       T06021                                 

Gene name
hisP
Definition
(GenBank) Histidine ABC transporter, ATP-binding protein HisP (TC 3.A.1.3.1)
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
daq  Dickeya aquatica
Pathway
daq02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:daq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DAQ1742_01337 (hisP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:daq02000]
    DAQ1742_01337 (hisP)
Enzymes [BR:daq01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     DAQ1742_01337 (hisP)
Transporters [BR:daq02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    DAQ1742_01337 (hisP)
   Histidine transporter
    DAQ1742_01337 (hisP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_13 ABC_ATPase AAA_29 AAA_15 Mg_chelatase AAA_16 AAA_23 AAA_33 PRK AAA_22 RsgA_GTPase AAA_24 NB-ARC NACHT ATPase_2 G-alpha
Motif
Other DBs
NCBI-ProteinID: SLM62329
UniProt: A0A375A9M1
Position
1339523..1340296
Genome map
AA seq 257 aa AA seqDB search
MQNNKLMVTELRKRYGQHEVLKGISLAAKAGDVISIIGSSGSGKSTLLRCINFLEKPCEG
SIHVNGQEIHMVRDKDGQLKVFDKKQLQLLRTRLTMVFQHFNLWSFMTALENVMEAPVQV
LGLSKDEARKRAEFYLNKVGITGVSQEKYPADLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMEFARHVSSHVIFLHQGVVEEEGPPDELF
NHPKSPRLQQFLSGALK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcagaataataagctgatggtgacggaattacgtaagcgttatggtcagcatgaagtg
ctcaaaggcatttcattggcggctaaagccggggacgttatttccattattggttcatca
gggtcgggtaagagtacgctgttgcggtgtattaactttttggaaaaaccgtgtgaaggc
tctattcatgtgaatggacaggaaattcacatggtgcgggataaagacgggcagctcaaa
gtgtttgataaaaaacagttgcagctgttacgcacccgcctgacgatggtattccagcac
tttaacctgtggagcttcatgacggcgctggaaaacgtgatggaagcgccagtgcaggtg
ctggggttaagcaaggatgaggcacgtaaacgggcggagttttatctcaacaaagtgggg
atcaccggcgtgtcacaggagaaatatccggctgacctctctggcgggcagcagcaacgg
gtgtcaattgcccgtgcgctggcaatggagccggatgtgttgctgtttgatgagccgacg
tctgcacttgacccagagctggtcggcgaagtgctgcgcatcatgcagcaactggccgaa
gagggcaaaacgatggtggtggtgacgcatgagatggagtttgcccgtcatgtgtcaagc
catgtgattttcctgcatcagggcgtggtggaagaggaagggccaccggatgaactgttt
aaccacccgaaaagccctcgcctgcaacagtttctgtcaggggcattgaaataa

DBGET integrated database retrieval system