KEGG   Dickeya aquatica: DAQ1742_01343Help
Entry
DAQ1742_01343     CDS       T06021                                 

Gene name
ackA
Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
daq  Dickeya aquatica
Pathway
daq00430  Taurine and hypotaurine metabolism
daq00620  Pyruvate metabolism
daq00640  Propanoate metabolism
daq00680  Methane metabolism
daq01100  Metabolic pathways
daq01120  Microbial metabolism in diverse environments
daq01200  Carbon metabolism
Module
daq_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:daq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DAQ1742_01343 (ackA)
   00640 Propanoate metabolism
    DAQ1742_01343 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    DAQ1742_01343 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DAQ1742_01343 (ackA)
Enzymes [BR:daq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DAQ1742_01343 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: SLM62335
UniProt: A0A375A8G8
Position
complement(1346146..1347348)
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGDEYLSGLAECFHLPEARIKWKIDGGKQEAALGAG
AAHSEALSFIVNSIINQKPELSAQLVAIGHRIVHGGEKFTQSAIINDDVLQGIKDAIPFA
PLHNPAHLIGIEEALKEFPHLADKNVAVFDTAFHQTMPEEAYLYALPYKLYKDQHIRRYG
AHGTSHFYVSREAAKILGKSVDDLNVITCHLGNGGSVTAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAVVFHLHDAMGMSVADINKLLTKESGLLGLTEVTSDCRYVEDNYETKEDAK
RAMNVYCHRLAKYIGSYCALMEGRLDAVIFTGGIGENAAMVRELTLKQLGLMGLEIDHER
NLAARFGKGGNIAKDGSRPALVIPTNEELVIAQDALRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttcttaactgtggtagttcttccctgaagttcgccatc
attgatgccgtcaacggagatgaatacctgtctggcctggccgaatgtttccacctgccc
gaagcgcgcatcaaatggaaaatcgatggcggcaaacaggaagccgcactgggtgccggt
gccgcccacagcgaagcactgagtttcatcgttaacagcatcatcaaccagaaaccggaa
ctctccgcacagctggtggcaatcggtcatcgtattgtgcacggcggcgagaaattcact
cagtccgctatcatcaacgacgatgtgctgcaaggcatcaaagatgccatcccgtttgcc
ccactgcacaacccggctcacttgattggcattgaagaagcgctgaaagaattcccgcat
ctggctgacaaaaacgtcgccgtttttgacaccgcattccaccagaccatgccggaagaa
gcctacctgtacgctctgccgtataagttatacaaagatcagcacattcgtcgttatggc
gcgcatggcaccagccacttctatgtttcccgcgaagcagcaaagatccttggcaaatct
gttgatgatctgaacgttatcacctgccatctgggtaatggtggttctgttactgcaatt
cgtaacggtaaatgcgtggatacctcaatgggcctgacaccgctggaagggctggtgatg
gggactcgtagtggtgatatcgacccggctgtcgtgttccacctgcacgatgccatgggc
atgagcgtagccgatatcaacaagctgttgaccaaagaatccggcctgctgggcctgacc
gaagtcaccagtgactgccgttatgttgaagataactatgaaaccaaagaagacgccaaa
cgcgcaatgaacgtgtactgccatcgtctggccaagtacatcggttcttactgtgcactg
atggaagggcgtctggatgccgttatcttcaccggtggtattggtgaaaacgccgcaatg
gtacgcgaactgacgctgaaacagctgggcctgatgggtcttgagatcgatcacgaacgc
aatctggcggctcgtttcggtaaaggcggcaacatcgccaaagacggcagccgcccggcg
ctggtcatcccaaccaacgaagagttggtgattgcacaagacgcgctgcgtctgactgcc
tga

DBGET integrated database retrieval system