KEGG   Dickeya aquatica: DAQ1742_03861Help
Entry
DAQ1742_03861     CDS       T06021                                 

Gene name
apaG
Definition
(GenBank) Protein associated with Co2+ and Mg2+ efflux
  KO
K06195  ApaG protein
Organism
daq  Dickeya aquatica
Brite
KEGG Orthology (KO) [BR:daq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DAQ1742_03861 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: SLM64650
UniProt: A0A375AEY5
Position
3869315..3869692
Genome map
AA seq 125 aa AA seqDB search
MMNAPRVCIQVQSFYVEAQSQPEDARFVFAYTITIRNLGRHDVKLLNRYWLITNGNGKQT
EVQGEGVIGLQPVIKPGGEFQYTSGAILETPMGTMEGYYQMIDHQGETFQAPITVFRLAI
PSLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgcgccccgagtttgcatacaggttcagagcttctatgtcgaagcgcaatcc
cagccagaggacgcgcgcttcgtctttgcctataccattactattcgtaatctggggcgt
catgacgtcaaactgcttaatcgctactggctgattaccaacggtaacggcaaacagacc
gaggtgcagggcgagggggttatcggccttcagcctgttatcaagcccggtggcgaattc
caatacaccagcggcgcgattctggaaaccccgatgggcaccatggaagggtattaccag
atgattgaccatcagggtgaaacatttcaggctcccattacggtatttcgtctggccatt
ccctcactcatacattaa

DBGET integrated database retrieval system