KEGG   Dickeya aquatica: DAQ1742_04456Help
Entry
DAQ1742_04456     CDS       T06021                                 

Gene name
arnA
Definition
(GenBank) UDP-glucuronic acid oxidase (UDP-4-keto-hexauronic acid decarboxylating) / UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
daq  Dickeya aquatica
Pathway
daq00520  Amino sugar and nucleotide sugar metabolism
daq01100  Metabolic pathways
daq01503  Cationic antimicrobial peptide (CAMP) resistance
Module
daq_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:daq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DAQ1742_04456 (arnA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    DAQ1742_04456 (arnA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:daq01005]
    DAQ1742_04456 (arnA)
Enzymes [BR:daq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     DAQ1742_04456 (arnA)
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     DAQ1742_04456 (arnA)
Lipopolysaccharide biosynthesis proteins [BR:daq01005]
 Unusual sugar
  DAQ1742_04456 (arnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Formyl_trans_N Formyl_trans_C 3Beta_HSD NAD_binding_10 Sacchrp_dh_NADP TrkA_N NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: SLM65201
UniProt: A0A375AH31
Position
complement(4465036..4467027)
Genome map
AA seq 663 aa AA seqDB search
MKAVVFAYHDLGCVGLRALVAAGYTVEAVFTHADNPAENQFFGSVARTAAELGIPVFAPE
DVNHPLWVERIAAMSPDVIFSFYYRNLLSDAILQSAPRGAFNLHGSLLPRYRGRAPLNWV
LVNGETETGVTLHRMVARADAGNIVAQHSVAIDDADTALSLHHKLRDAARNVLETALPAI
KAGNAQETAQDESQATYVGRRTPEDGRIEWQKPARALFNLVRAVTEPWPGAFSFVGTTKF
IIWQTKIRTDFPAAKPGTVLSTSPLVVACGSDALEIVTGQGDNGIYLQGSQLAQSLGLVT
GAILNNSPMVSVKRRTRVLILGVNGFIGNHLTERLLQEDNYEVFGLDISSDAIERFLGNP
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKTIRDC
VKYKKRIIFPSTSEVYGMSTDPVFDEDNSNLIVGPINKQRWIYSVSKQLLDRVIWAYGEK
EGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLVDGGRQKRCFTDI
KDGIEALFRIIENKNGVCDGQIINIGNPDNEASIRQLAEQLLESFEKHPLRNQFPPFAGF
REVESSSYYGKGYQDVEHRKPSIRNAKRLLNWQPSIEMEKTVAETLDFFLQTVENGQFSQ
DGE
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgtttttgcctatcatgatctcggctgcgtgggactccgcgcgttagtg
gcagcgggttataccgtagaagcggtgtttacccacgcagataatccagcggaaaatcag
ttctttggatcggttgcccgtactgcggcggagctgggaattccggtttttgcgcccgaa
gacgtcaaccacccgctgtgggttgagcgtatcgcggcgatgtcgccggacgtgattttc
tcgttctattatcgcaacctgttgagcgatgccattttgcaaagcgcgccgcgcggtgca
ttcaacctgcatggctcgctgctgccgcgctaccgtggccgcgcgccgctgaactgggta
ttggttaacggtgaaaccgaaaccggcgtgacgttgcaccgcatggtggcgcgtgccgac
gccggtaacattgttgcccagcacagcgtggcaattgacgatgccgataccgcgctcagt
ctgcaccataaattgcgtgatgccgcccgcaacgtgctggaaaccgcgctgccggccatt
aaagccggtaacgcacaggaaaccgcgcaggatgaaagccaggccacctatgttggccgc
cgtaccccggaagatggccgcattgagtggcagaaaccggcgcgtgcgctgtttaacctg
gtgcgcgcggtgacggaaccgtggccgggcgcgttcagcttcgtcggcaccaccaaattt
attatctggcagaccaaaatccgtaccgatttcccggcggcgaaaccgggtacggtgctc
agtacctcgccgctggtggtcgcctgtggtagcgatgcgctggaaatcgtgaccgggcag
ggcgataacggtatttatctgcaaggttcgcaactggctcaaagccttggcctggtgacg
ggtgccatcctcaataattcaccgatggtgagcgtgaagcgccgcacccgcgtcttgatt
cttggcgtgaatggttttatcggcaaccacctgaccgagcgtttgttgcaggaagataac
tacgaagtgttcgggctggacatcagttccgatgccattgagcgcttcctcggtaatccg
cgtttccacttcgtggaaggcgatatcagcattcactctgagtggattgaataccacatc
aaaaaatgtgatgtggtgctgccgctggtggccatcgctacgccgattgagtacacccgt
aacccgctgcgcgtgttcgagctggatttcgaagagaacctgaaaaccatccgtgattgc
gtgaagtacaaaaaacgcatcattttcccgtccacgtctgaagtgtacggcatgtctacc
gacccggtgttcgacgaagacaactctaaccttatcgtcgggcctatcaacaaacagcgc
tggatttactcggtatccaagcaactgctggatcgcgttatctgggcttacggcgaaaaa
gaggggctgcgtttcaccctgttccgtccgttcaactggatggggccgcgtctggataac
ctgaatgccgcgcgtatcggcagctctcgcgccatcacccagttgatcctgaacctggtg
gaaggctcgcctatcaagctggtggacggtggtcggcagaaacgctgctttaccgacatc
aaagacgggattgaagcgctgttccgcatcatcgaaaacaaaaatggtgtgtgcgacggg
caaatcatcaacatcggcaacccggacaacgaagcgagcattcgccagctggcagaacag
ctgctggagagctttgagaagcacccgctgcgtaaccagttcccgccgtttgccggtttc
cgtgaagtggaaagcagcagctactacggcaaaggctatcaggatgtggagcaccgcaaa
ccgagcatccgtaatgccaaacgtctgttgaactggcagccttcgattgagatggaaaaa
accgtggcagaaacgctggacttcttcctccagaccgttgagaacgggcagtttagtcag
gacggcgaataa

DBGET integrated database retrieval system