KEGG   Dechloromonas aromatica: Daro_2096
Entry
Daro_2096         CDS       T00259                                 

Name
(GenBank) Formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
dar  Dechloromonas aromatica
Pathway
dar00620  Pyruvate metabolism
dar00640  Propanoate metabolism
dar00650  Butanoate metabolism
dar01100  Metabolic pathways
dar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daro_2096
   00640 Propanoate metabolism
    Daro_2096
   00650 Butanoate metabolism
    Daro_2096
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     Daro_2096
SSDB
Motif
Pfam: PFL-like Gly_radical DUF3029 TetR_C_4
Other DBs
NCBI-ProteinID: AAZ46839
UniProt: Q47E92
Position
2254401..2256656
AA seq 751 aa
MNTMTKITSRADAWEGFVGNDWKTSVDVRGFIQANFTPYAGNSAFLQGPTQRTTALWAKL
EVLLKQEQAKGVLDVSADRPSTITAHDAGYIDRDSEIIVGLQTDAPLKRAIMPNGGVRMV
EGGLKAYGFRLDPTVAEIWSKYRKDHNSGVFDVYSPEIAKARKSAILTGLPDAYGRGRII
GDYRRVALYGVDALRKFKKAEFHELDSAEFTESVIRLREEVSEQYRALDELKQMAAKYGF
DIGRPAANAQEAVQWTYFGYLAAIKEQNGAAMSIGRISTFLDIYMERDMAAGLIDEAQAQ
EMMDDLVIKLRIVRFLRTPEYDQLFSGDPTWVTESIGGVGEDGRPLVTKNSFRILHTLNN
LGPAPEPNLTVLWSEKLPQGFKDFCAKTSIETCSLQYENDDLMRPHWGDDYGIACCVSAM
RIGKQMQFFGARANLAKAMLYAINGGRDEISGEQVGPTFEPIVGEVLDYDEVVARFLPMM
EWLSGVYMKALNTIHFMHDKYAYERIEMALHDRDILRTMACGIAGLSVVADSLSAMRHAK
VHVVRDERGLASDFRIEGDYPSYGNNDDRVDSIATWLVETFMGYLRRERTYRDAVPTMSV
LTITSNVVYGKKTGNTPDGRKAGQPFAPGANPMHGRDHKGALASMASVCKLPYGCSQDGI
SYTFTIVPSALGPTEKERVGNLATMLDGYFASNGHHVNVNVFDRETLMHAMDHPELYPQL
TIRVSGYAVNFVKLTREQQLDVISRTFHVSH
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgaacaccatgaccaagatcaccagccgggccgatgcctgggaaggttttgtcggtaac
gactggaagacctccgtcgatgtccgcggcttcatccaggccaacttcaccccttacgcc
ggcaacagcgcctttctgcagggcccgacccagcgtaccactgccctctgggccaaactc
gaagtgttgctcaagcaggaacaggccaagggcgttctcgatgtttccgccgaccgcccc
tcgaccatcaccgcccacgacgcaggctatatcgatcgcgacagtgaaatcatcgtcggc
ctgcaaaccgatgcgcccctgaagcgcgccatcatgccgaacggcggcgtgcgcatggtc
gaaggcggcctcaaggcttacggtttcaggctcgacccgaccgtggccgagatctggagc
aagtatcgcaaggatcacaacagcggcgtcttcgacgtctattcgccggaaatcgccaag
gcccgcaaatcggccatcctgaccggcctgcccgatgcctatgggcgtggccgcatcatt
ggtgactatcgccgtgtcgccctgtacggcgtcgatgcgctgcgcaagttcaagaaagcg
gaattccatgagctggatagcgccgaattcaccgaaagcgtcatccgcctgcgcgaggaa
gtcagcgaacaatatcgcgccctcgacgagctgaaacagatggccgccaagtatgggttc
gacatcggtcgcccggcggccaatgcccaggaagccgtgcagtggacctacttcggctac
ctggcggcgatcaaggaacagaacggtgccgccatgtcgatcggccgcatctcgaccttc
ctcgacatctacatggaacgcgacatggccgccggcctgatcgacgaagcgcaggcccag
gaaatgatggacgacctggtcatcaagctgcgcatcgtccgcttcctgcgcaccccggaa
tacgaccagctgttctcgggcgacccgacctgggtcaccgaatcgatcggcggtgtcggt
gaggatggccggccgctcgtcaccaagaacagtttccgtatcctgcacaccctcaacaac
ctgggccccgccccggaacccaacctgacggtgctgtggtccgagaaattaccccagggc
ttcaaggatttctgcgccaagacctcgatcgagacctgctccctgcaatatgaaaacgac
gacctgatgcgcccgcactggggcgacgactacggtatcgcctgctgcgtctcggccatg
cgcatcggcaagcagatgcagttcttcggggcccgggccaatctggccaaagccatgctc
tacgcgatcaatggcggtcgcgacgaaatcagcggcgagcaggtcggcccgacctttgag
cctatcgtcggcgaggtgctggattacgacgaggtcgtcgccaggttcctgcccatgatg
gaatggctgagcggcgtttatatgaaggcgctgaacaccatccacttcatgcacgacaaa
tacgcctacgagcgcattgaaatggcgctgcacgaccgcgacatcctgcgcaccatggct
tgcggcattgctggcctgtcggtggtcgccgattcactctccgccatgcgtcacgccaaa
gtccatgtcgtgcgcgacgagcgtgggctggccagcgacttccgcatcgaaggcgactac
ccgtcctatggcaacaacgatgaccgcgtcgattcgattgccacctggctggtcgagacc
ttcatgggctatctgcgtcgcgagcggacctatcgcgatgccgtaccgaccatgtcggtg
ctgaccattacatccaacgtggtttatgggaagaagaccggcaacacgccggacggtcgc
aaggccggccagcctttcgcgccgggcgccaacccgatgcacggccgggatcacaagggg
gcactggcctccatggcctcggtctgcaagctgccctacggctgctcgcaggacggtatt
tcctacaccttcaccatcgtgcccagtgcgcttggcccgacggagaaggaacgagtgggc
aatctggcgaccatgctcgatggctatttcgcgagcaacggtcaccacgtcaatgtgaat
gtcttcgatcgtgaaacgctgatgcacgccatggatcacccggagttgtacccgcaactc
accatccgggtatcaggttatgcggtgaacttcgtcaagctcacccgcgaacagcagctg
gacgtgatcagccgcaccttccatgtctcccactaa

DBGET integrated database retrieval system