KEGG   Dechloromonas aromatica: Daro_0441Help
Entry
Daro_0441         CDS       T00259                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dar  Dechloromonas aromatica
Pathway
dar00010  Glycolysis / Gluconeogenesis
dar00020  Citrate cycle (TCA cycle)
dar00620  Pyruvate metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
Module
dar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_0441
   00020 Citrate cycle (TCA cycle)
    Daro_0441
   00620 Pyruvate metabolism
    Daro_0441
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Daro_0441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 PYNP_C HlyD_D23 RnfC_N DEC-1_N DUF4813
Motif
Other DBs
NCBI-ProteinID: AAZ45198
UniProt: Q47IY3
Position
complement(484115..485755)
Genome map
AA seq 546 aa AA seqDB search
MSQIIEVTVPDIGDFDSVPVIDLFVKVGDTIKVDDAIVTLESDKATMDVPSTVAGVVKEV
LVSLGSKVGEGALLIKVETGGAAAEPAAAPAPAAQAAAPAPAPAAAPVAAAPAAGGGVVE
VKVPDIGDFAEVPVIELYVKVGDAIKVDDAIATLESDKATMDVPSTVAGTVKEVLVQIGS
KVGEGTVLIKVESGASAPAAAPQAAAPAPAAAAPAPVAAPVAAPAAASPAALAPALAAGS
KVHASPSVRAYARELGVDLNKVPATGPKNRIVKEDLTKYVKGVMSGAVAGPTAGGGASLG
GGLDLLPWPKVDFAKFGEIEVKPLSRIKKISGQNLSRNWVMIPAVTYHEDADITDIEAFR
VLLNKENEKGGGAKLTMLAFLMKACVKGLQKFPEFNSSLDGDNLVLKKYFNIGFAADTPN
GLVVPVVKNVDKKSVFELAQESGDLAKQARDGKLKPADMSGACFTISSLGGIGGTYFAPI
VNAPEVAILGVNKSAMKPVWDGKQFVPRLVLPLSLTADHRVIDGALATRFNVYIAQLLAD
FRRVAL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatcattgaagtcacagtccccgatatcggcgatttcgacagcgttccggtc
atcgacctgttcgtcaaagtcggcgacaccatcaaggttgacgacgccatcgtcacgctg
gaatccgacaaggccacgatggatgttccttccaccgttgccggcgtcgtcaaggaagtg
ctggtctcgctcggctccaaagtcggcgaaggcgccctgctgatcaaggttgaaaccggc
ggcgctgcggccgagccggcagccgcccctgctccggcggcgcaagccgctgcgccggca
ccagcacccgctgctgcaccggtcgctgctgcgcctgcagccggtggtggcgtggttgaa
gtcaaggtcccggatattggcgatttcgccgaagtcccggtcatcgagttgtacgtcaag
gttggcgacgccatcaaggttgatgacgcgatcgccacgctggaatccgacaaggcgacg
atggatgttccgtccaccgtcgccggtacggtcaaggaagtgctcgtccagatcggctcc
aaggtcggtgaaggcacggttctgatcaaggttgaaagtggtgcctcggctccggccgct
gccccgcaagctgctgctccggcacctgctgctgcagctccggctcccgttgccgcgcct
gttgctgctccggcagccgcatccccggccgcactagccccggcactggccgctggcagc
aaggttcacgcctcgccgtcggtccgtgcctatgcccgcgaactcggtgtcgatctgaac
aaggtgccggcgaccggcccgaaaaaccgcatcgtcaaggaagacctgaccaagtacgtc
aagggcgtcatgtccggtgctgtagccggaccgactgctggcggcggtgccagcctcggc
ggcggtctcgatctgctgccctggccgaaggttgatttcgccaagttcggcgaaatcgag
gtcaagccgctgtcgcgcatcaagaagatttccggccagaacctgtcgcgcaactgggtg
atgatcccggccgtgacctatcacgaagatgccgacatcaccgatatcgaagccttccgc
gtgctgctcaacaaggaaaacgaaaagggtggcggcgccaagctgaccatgctcgctttc
ctgatgaaggcttgcgtcaagggcctgcagaaattcccggaattcaattcctcgctcgac
ggcgacaatctggtgctgaagaagtatttcaacatcggtttcgcggctgataccccgaac
ggcctggtcgtgccggtggtcaagaatgtcgacaagaagtcggtcttcgaactggcgcag
gaatccggtgatctggccaagcaggcgcgtgacggcaagctgaagccggccgacatgtcc
ggtgcctgcttcacgatttccagcctgggcggtatcggcggcacttacttcgcaccgatc
gtcaatgcaccggaagtcgccatcctcggcgtcaacaagtcggccatgaaaccggtctgg
gacggcaagcaattcgtgccgcgcctcgtcctgccgctgtcgctgaccgccgaccaccgc
gtcatcgacggtgcgctggcgacccgcttcaatgtctatatcgcccagctgctggccgac
ttccgtcgcgtcgcgctgtaa

DBGET integrated database retrieval system